KEGG   Streptococcus suis S735 (serotype 2): YYK_06940Help
Entry
YYK_06940         CDS       T02214                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sup  Streptococcus suis S735 (serotype 2)
Pathway
sup00071  Fatty acid degradation
sup00072  Synthesis and degradation of ketone bodies
sup00280  Valine, leucine and isoleucine degradation
sup00362  Benzoate degradation
sup00380  Tryptophan metabolism
sup00620  Pyruvate metabolism
sup00630  Glyoxylate and dicarboxylate metabolism
sup00640  Propanoate metabolism
sup00650  Butanoate metabolism
sup00900  Terpenoid backbone biosynthesis
sup01100  Metabolic pathways
sup01110  Biosynthesis of secondary metabolites
sup01120  Microbial metabolism in diverse environments
sup01130  Biosynthesis of antibiotics
sup01200  Carbon metabolism
sup01212  Fatty acid metabolism
sup02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YYK_06940
   00630 Glyoxylate and dicarboxylate metabolism
    YYK_06940
   00640 Propanoate metabolism
    YYK_06940
   00650 Butanoate metabolism
    YYK_06940
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YYK_06940
   00072 Synthesis and degradation of ketone bodies
    YYK_06940
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YYK_06940
   00310 Lysine degradation
    YYK_06940
   00380 Tryptophan metabolism
    YYK_06940
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YYK_06940
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YYK_06940
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YYK_06940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sup04147]
    YYK_06940
Enzymes [BR:sup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     YYK_06940
Exosome [BR:sup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YYK_06940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N
Motif
Other DBs
NCBI-ProteinID: AFR00901
Position
1438814..1439998
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALASKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVLILMSDEKASELNIQPLTYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctagt
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctggctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagcaggtttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttgatactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcacctatattgaggcctatgcaacaagc
ggtttagatcccgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaacgaggcatttgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system