KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_10119Help
Entry
HMPREF0772_10119  CDS       T01889                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
suq00010  Glycolysis / Gluconeogenesis
suq00260  Glycine, serine and threonine metabolism
suq00680  Methane metabolism
suq01100  Metabolic pathways
suq01110  Biosynthesis of secondary metabolites
suq01120  Microbial metabolism in diverse environments
suq01130  Biosynthesis of antibiotics
suq01200  Carbon metabolism
suq01230  Biosynthesis of amino acids
Module
suq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suq_M00002  Glycolysis, core module involving three-carbon compounds
suq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0772_10119
  Energy metabolism
   00680 Methane metabolism
    HMPREF0772_10119
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0772_10119
Enzymes [BR:suq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0772_10119
Membrane trafficking [BR:suq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HMPREF0772_10119
Exosome [BR:suq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0772_10119
  Exosomal proteins of melanoma cells
   HMPREF0772_10119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADQ75581
Position
complement(132369..132950)
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQIKHVYVSDL
LRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFKDFRHS
FSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNKVSREEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggcgaatcaaaatcgaattatgataataaacatttt
agatcttatttttgtggacaattagatgtgccgttaacggatactggcacaaaaagtgcg
gacgatttatgtgattattttaaagagaaacagattaaacatgtatatgtttcagactta
ttaagaacacagcaaacgtttgaacatatttttccatatgacattgcatcaacgactacc
cctctattaagagaacgttcacttggcgtatttgagggtgaatataaagatgaaatcagt
gcgaatccgaaatatgaaaaatatttcaatgatccaaactttaaagactttcgacatagt
ttttcacaaaaagcgcctgaaggagaaagttatgaagatgtatatcaacgcgtagaacat
tttatgaatcatgttgtcaatgaagatacacaaaaagatgatatcgtcattgttgcacat
caagttgtcattcgttgtttgatggtttattttaacaaagtttcaagggaagaagctgtg
gatttaaaggtagaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system