KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_10140Help
Entry
HMPREF0772_10140  CDS       T01889                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
suq00071  Fatty acid degradation
suq00072  Synthesis and degradation of ketone bodies
suq00280  Valine, leucine and isoleucine degradation
suq00310  Lysine degradation
suq00362  Benzoate degradation
suq00380  Tryptophan metabolism
suq00620  Pyruvate metabolism
suq00630  Glyoxylate and dicarboxylate metabolism
suq00640  Propanoate metabolism
suq00650  Butanoate metabolism
suq00900  Terpenoid backbone biosynthesis
suq01100  Metabolic pathways
suq01110  Biosynthesis of secondary metabolites
suq01120  Microbial metabolism in diverse environments
suq01130  Biosynthesis of antibiotics
suq01200  Carbon metabolism
suq01212  Fatty acid metabolism
suq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF0772_10140
   00630 Glyoxylate and dicarboxylate metabolism
    HMPREF0772_10140
   00640 Propanoate metabolism
    HMPREF0772_10140
   00650 Butanoate metabolism
    HMPREF0772_10140
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0772_10140
   00072 Synthesis and degradation of ketone bodies
    HMPREF0772_10140
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMPREF0772_10140
   00310 Lysine degradation
    HMPREF0772_10140
   00380 Tryptophan metabolism
    HMPREF0772_10140
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0772_10140
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HMPREF0772_10140
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HMPREF0772_10140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suq04147]
    HMPREF0772_10140
Enzymes [BR:suq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HMPREF0772_10140
Exosome [BR:suq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0772_10140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: ADQ75602
Position
complement(150339..151520)
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEINEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPAIMGIAPVDAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattaatgaagtcatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgttgtcactaaggatgaaggtgta
cgtgaaaatgtatcagttgaaaaattaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatcctgctattatgggtattgccccagttgacgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagtgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacatcctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system