KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_10314Help
Entry
HMPREF0772_10314  CDS       T01889                                 

Gene name
rocD
Definition
(GenBank) ornithine aminotransferase
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
suq00330  Arginine and proline metabolism
suq01100  Metabolic pathways
suq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    HMPREF0772_10314 (rocD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:suq01007]
    HMPREF0772_10314 (rocD)
Enzymes [BR:suq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     HMPREF0772_10314 (rocD)
Amino acid related enzymes [BR:suq01007]
 Aminotransferase (transaminase)
  Class III
   HMPREF0772_10314 (rocD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADQ75776
Position
340399..341583
Genome map
AA seq 394 aa AA seqDB search
MNSIIELTDYYSSNNYAPLKLVITEGKGGKVWDTDGKQYIDCISGFSVANQGHCHPTIVK
AMTEQASKLSIISRVLYSDNLGKWEEKICHLAKKDKVLPLNSGTEAVEAAIKIARKWGSD
VKGITDGQVEIIAMNNNFHGRTLGSLSLSNHDAYKSGFHPLLQGTKTVDFGDIEQLTQAI
SPNTAAIILEPIQGEGGVNIPPKGYIQAVRQLCDKHQILLIADEIQVGLGRTGKWFAMEW
EQVVPDIYILGKALGGGLYPVSAVLANNDVMRVLTPGTHGSTFGGNPLAIAISTAALDVL
KDEQLVERSERLGSFLLKALLQLKHPSIKEIRGRGLFIGIELNTDAAPFVEQLIKRGILC
KDTHRTIIRLSPPLVIDKEEINQIVAAFQDVFKN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaatcattgaattaactgattattatagctctaataattatgcaccactgaag
cttgtaattactgaagggaaagggggcaaagtttgggatactgatggcaaacaatatata
gattgcatttcgggtttttcagttgcaaaccaaggccattgtcatccaacaattgttaaa
gcgatgacagaacaagcttcaaagttgtctatcatttcacgtgtcctttatagtgacaat
ctcgggaaatgggaagaaaaaatttgtcatcttgctaagaaagacaaagtactccccctt
aactctggtactgaagctgttgaagcagccattaaaattgctagaaaatggggctctgac
gttaaaggcatcactgacggacaagttgaaatcatcgctatgaataacaattttcacggt
cgtacacttggctcattatcactatctaaccacgacgcatataaatcaggatttcacccc
ctacttcaaggtactaaaacagtagattttggagatattgagcaattaacacaagctatt
tcaccaaatacagcagcaattattttagaaccaattcaaggtgaaggtggcgttaatata
ccaccgaaaggatatatccaagctgtgcgtcaactatgtgataaacatcaaatattattg
attgcagatgaaattcaagttggtcttggtagaactgggaaatggtttgcgatggaatgg
gagcaagtcgttccagacatttatattttaggtaaggcattgggtggcggcttataccct
gtatctgctgtgcttgcaaataatgatgtcatgcgagttctaacaccaggtacacatggc
tcaacatttggtggtaaccctttagccattgcaatatcgacggcagcgcttgatgtactt
aaagatgaacaactggttgaacgatcagaacgcttaggttcatttttattaaaagcgttg
ctacaacttaaacatcctagtattaaagaaattagaggtcgtggtttatttattggcatc
gaacttaacacagatgccgcacctttcgttgaacaactgattaaacgtggcattttatgc
aaagacacgcatcgtactatcattcgattgtcaccacctctagtcattgataaagaggaa
atcaatcaaattgttgcagcttttcaagacgtttttaaaaattaa

DBGET integrated database retrieval system