KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_10953Help
Entry
HMPREF0772_10953  CDS       T01889                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
suq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:suq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HMPREF0772_10953 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:suq03011]
    HMPREF0772_10953 (rplV)
Ribosome [BR:suq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HMPREF0772_10953 (rplV)
  Bacteria
    HMPREF0772_10953 (rplV)
  Archaea
    HMPREF0772_10953 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Peptidase_C92
Motif
Other DBs
NCBI-ProteinID: ADQ76415
Structure
PDB: 

Position
1022357..1022701
Genome map
AA seq 114 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEH
NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctagaacaataagaatcgcacctcgtaaagtaagactagtt
cttgacttaatcagaggtaaaaatgctgctgaagctattgcaattttaaaattaacaaac
aaagcttcatcaccagtaattgaaaaagtattaatgtccgctttagctaatgctgaacat
aactatgacatgaacacagatgaattagtagttaaagaagcatatgctaacgaaggacca
acattaaaacgtttccgtccacgtgcgcaaggtcgtgcaagtgcgattaacaaacgtaca
agccacattacaatcgtcgtaagtgacggtaaagaagaagcttaa

DBGET integrated database retrieval system