KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11483Help
Entry
HMPREF0772_11483  CDS       T01889                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
suq00860  Porphyrin and chlorophyll metabolism
suq01100  Metabolic pathways
suq01110  Biosynthesis of secondary metabolites
suq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:suq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0772_11483 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:suq01007]
    HMPREF0772_11483 (hemL)
Enzymes [BR:suq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     HMPREF0772_11483 (hemL)
Amino acid related enzymes [BR:suq01007]
 Aminotransferase (transaminase)
  Class III
   HMPREF0772_11483 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADQ76945
Position
1581108..1582394
Genome map
AA seq 428 aa AA seqDB search
MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLS
WGPLILGHRDPQVISHLHEAIDKGTSFGASTLLENKLAQLVIDRVPSIEKVRMVSSGTEA
TLDTLRLARGYTGRNKIVKFEGCYHGHSDSLLIKAGSGVATLGLPDSPGVPEGIAKNTIT
VPYNDLDALKIAFEKFGDDIAGVIVEPVAGNMGVVPPIEGFLQGLRDITTEYGALLIFDE
VMTGFRVGYHCAQGHFGVTPDLTCLGKVIGGGLPVGAFGGKKEIMDHIAPLGNIYQAGTL
SGNPLAMTSGYETLSQLTPETYEYFNMLGDILEDGLKRVFAKHNVPITVNRAGSMIGYFL
NEGPVTNFEQANKSDLKLFAEMYREMAKEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFD
TALSRIVK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagatatacgaagtcagaagaagcaatgaaggttgctgaaactttaatgcctggtggt
gtaaatagtccagtacgcgcatttaaatcagtagatacaccagcaatttttatggatcac
ggtaaaggctcaaaaatttatgatatcgatggtaacgagtatatcgactatgtactaagt
tgggggccacttattttaggacatagagaccctcaagttattagtcatttacatgaagca
attgataaaggtacaagttttggtgcatcaacattacttgaaaataaattggcgcagctc
gttattgaccgagtaccttcaatagaaaaagtgcgtatggtgtcatctggtacagaagct
acattggatactttaagattagcacgtggttatactggcagaaataaaattgtaaaattt
gaaggttgctatcatggtcatagtgattcgttattaatcaaagctgggtcaggggtggca
acattaggattgccggattctcctggtgtgcctgaaggtattgctaaaaatacaattaca
gttccatacaatgatttagatgcacttaaaatcgctttcgaaaaatttggagacgatatt
gctggtgtaatcgtagaacctgttgctggtaatatgggtgtcgtaccgccgattgaaggt
tttttacagggattaagagatattacgactgaatacggcgcattgctaattttcgatgaa
gtaatgactggtttcagagtcggttatcattgtgcacaaggtcactttggtgtgacacca
gatttaacttgcttaggaaaagttatcggtggaggactaccagtaggtgcttttggtggt
aaaaaagaaatcatggatcatatagcaccattaggaaatatttatcaagctggtacgtta
tcaggaaatcctcttgcaatgacaagtggttatgaaacgttaagtcaattaacgccagag
acatatgagtattttaatatgttaggcgatatacttgaagacggtttaaagcgtgtattt
gctaaacacaatgtaccaataactgtaaatagagcaggttcaatgattggttatttctta
aatgaaggacctgtaactaattttgaacaagcgaataaaagtgatttgaaattatttgca
gaaatgtatcgtgaaatggcaaaagaaggtgtgtttttaccaccatctcaatttgaaggt
acattcttatctacggcacacacgaaagaagatattgaaaaaacgattcaagcatttgat
acggctttaagtcgtattgtaaaataa

DBGET integrated database retrieval system