KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_12613Help
Entry
HMPREF0772_12613  CDS       T01889                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
suq00071  Fatty acid degradation
suq00072  Synthesis and degradation of ketone bodies
suq00280  Valine, leucine and isoleucine degradation
suq00310  Lysine degradation
suq00362  Benzoate degradation
suq00380  Tryptophan metabolism
suq00620  Pyruvate metabolism
suq00630  Glyoxylate and dicarboxylate metabolism
suq00640  Propanoate metabolism
suq00650  Butanoate metabolism
suq00900  Terpenoid backbone biosynthesis
suq01100  Metabolic pathways
suq01110  Biosynthesis of secondary metabolites
suq01120  Microbial metabolism in diverse environments
suq01130  Biosynthesis of antibiotics
suq01200  Carbon metabolism
suq01212  Fatty acid metabolism
suq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF0772_12613
   00630 Glyoxylate and dicarboxylate metabolism
    HMPREF0772_12613
   00640 Propanoate metabolism
    HMPREF0772_12613
   00650 Butanoate metabolism
    HMPREF0772_12613
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0772_12613
   00072 Synthesis and degradation of ketone bodies
    HMPREF0772_12613
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMPREF0772_12613
   00310 Lysine degradation
    HMPREF0772_12613
   00380 Tryptophan metabolism
    HMPREF0772_12613
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0772_12613
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HMPREF0772_12613
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HMPREF0772_12613
Enzymes [BR:suq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HMPREF0772_12613
Exosome [BR:suq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0772_12613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADQ78075
Position
complement(2722982..2724133)
Genome map
AA seq 383 aa AA seqDB search
MNYNMNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNV
VGNGGNIARKALLEAGLKDSISGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVEST
SRAPWKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYGVSRELQDEFAYR
SHQLTAENVKNGNISQEILPITVKGELFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANS
CMKNDGAVLLLIMEKDMAYELGFDHGLLFKDGVTVGVDSNLPGIGPVPAISNLLKRNQLT
IENIEVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFD
KESMIASMGIGGGLGNAALFTRF
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgaattataatatgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaa
tatggtggcactttaaaacatttagagccagaacaattgctcaaacctttattccaacat
tttaaagagaagtatccagaggtaatatctaaaatagatgatgtagttttaggtaatgtt
gttgggaatggtggcaatattgcaagaaaagcattgcttgaagcggggctcaaagattca
atatctggcgtcacaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgca
tgtcgcatgattcaagccggagctggcaaggtatatattgcaggcggtgttgaaagtaca
agtcgagcaccttggaaaatcaaacgaccgcattctgtgtacgaaaccgcattacctgag
ttttatgagcgtgcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgct
gaaaatgtagccaagatgtatggtgtttcaagagaattacaagatgaatttgcttaccga
agtcatcaactgacagcggaaaatgtaaagaatggaaatatttctcaggaaatattacct
ataaccgttaaaggagaactattcaacactgatgaaagtctaaaatcacatattccgaaa
gataactttggccgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagt
tgtatgaaaaatgatggtgcagttctattgcttattatggaaaaagatatggcatacgaa
ttaggtttcgatcatggtttattatttaaagatggtgttacggtaggtgttgattctaat
ttacctggcattggtccagtaccagccatttccaacttactaaaaagaaatcaattaacg
atagaaaatattgaagtcattgaaattaacgaagcgttcagtgcacaggtggttgcctgc
caacaagctttaaatatttcaaatacgcaattaaatatatggggtggtgcattagcatca
ggtcatccatacggtgcaagcggtgcccaattagtgacgcgattattttatatgtttgac
aaagagagtatgattgcatctatggggattgggggaggtctaggaaatgcagcattattt
actcgattctaa

DBGET integrated database retrieval system