KEGG   Stigmatella aurantiaca: STAUR_1106Help
Entry
STAUR_1106        CDS       T01425                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00300  Lysine biosynthesis
sur01100  Metabolic pathways
sur01120  Microbial metabolism in diverse environments
sur01230  Biosynthesis of amino acids
Module
sur_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    STAUR_1106
Enzymes [BR:sur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     STAUR_1106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: M20_dimer Peptidase_M20 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADO68910
UniProt: Q09A34
Position
1319823..1320908
Genome map
AA seq 361 aa AA seqDB search
MSQLAARLAQSTLSLCRIASPIGHEGPLADHVERWALERFRREEVLRVGHSLFVGHLEDA
RPTVALVGHLDTVPGHPSDKEARLEGDRVFGLGASDMKGGLAVMMALAEDLPLRELPVNL
GFILYEREEGRYVESGLGPLFDTLPALRTVRFGIAMEPTDGLVQVGCVGTLHATLKFTGR
SAHSARPWQGENAIHKAGPLLTELLARQRVEVMHAGFPFYEVMSVTMASGGRARNVVPDT
LELNLNYRFAPGRTLAQAQEDVTALVAGRAEVTFTDLSPSGRVCADNPMYQQLLALTGLP
AASKQAWTDVARFGEWGVDAVNYGPGETAQAHQANESAPIPALAQAYEKLSAFLRGAKAA
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcttgccgcgcgccttgcccagtccacgctgtcgctgtgccgtattgccagc
cccatcggtcacgaggggcccctcgcggaccatgtggagcgatgggcgttggagcgcttc
cggcgcgaggaggtgcttcgggttgggcactcgctgttcgtcgggcacctcgaggatgca
cggcccacggtcgcgttggtggggcacctggacaccgtgccgggccaccccagtgacaag
gaggcgcggctcgaaggggaccgggtgtttgggctgggcgcctcggacatgaagggcggg
ctggcggtgatgatggcgctggcggaggacctgcccttgcgcgaactgccggtgaacctc
gggttcatcctctatgagcgcgaggagggccgctatgtggagagcgggctgggcccgctg
ttcgacacgctcccggcgctgcggacggtccgcttcggcatcgccatggagccgacggac
gggctggtgcaggtggggtgcgtggggacgctgcacgccacgctgaagttcacgggccgc
agcgcgcactcggcgcggccgtggcaaggcgagaacgccattcataaggcgggccccttg
ctgacggaattgctggcgcgccagcgggtggaggtgatgcacgccggctttccgttctac
gaggtgatgagcgtgacgatggcgagcggaggccgcgcccgcaacgtggtgccggacacg
ctggagctgaacctcaactaccgcttcgcgccgggccggaccctggcccaggcgcaggaa
gacgtgacggccctggtggcggggcgggcagaggtgaccttcacggacctctcccccagt
ggccgcgtgtgcgcggacaaccccatgtaccagcaactcctggcgctgacggggctgccc
gcggcgtcaaagcaggcctggacggacgtggcccggttcggcgagtggggcgtggatgcg
gtgaactacggccccggggagacggcgcaggcgcaccaggccaacgagagcgcgcccatt
ccagcgctggcgcaagcttatgaaaagctctccgcgttcctgcggggggccaaggccgcg
ctctag

DBGET integrated database retrieval system