KEGG   Stigmatella aurantiaca: STAUR_1300Help
Entry
STAUR_1300        CDS       T01425                                 

Definition
(GenBank) Aromatic amino acid hydroxylase, biopterin-dependent
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00360  Phenylalanine metabolism
sur00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sur00790  Folate biosynthesis
sur01100  Metabolic pathways
sur01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    STAUR_1300
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STAUR_1300
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STAUR_1300
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     STAUR_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ADO69104
UniProt: Q08RX0
Position
complement(1585524..1587113)
Genome map
AA seq 529 aa AA seqDB search
MTPTERTLARLPAHLRRYVVGQDYASYTPRDQAVWRHILRRLSRHLSDKAHPVYLEGLQA
TGIGVERIPSLDEMNERLARLNWAAVGVRGFIPPAVFTELQSMRVLAIAADIRTHEHIPY
TPAPDIVHESAGHAPILAHARYAEYLQRSGVVGFKSIATVEDQAVFEAIRHLSVVKEDPT
STPAAVEHAQARLEAASQSRRYVSESTQASRLYWWTAEYGLVGSLEQPRLYGAGLLSSIG
EAEHCFTPAVKRVPLSLECVRTDYDITRMQPQLFVARDFEHLFEVLEAFEATLSWKRGGD
YGLQEAQRARTVNHLVLSDGREITGRVVELLPGTRPVAEGLSTALVSLAGPLMLSQNGKS
LGKPWQSLTLVAFGEGKLPEQGPFQLELASGLRLEGFAGGEGEVLRLRGSLGGRPLELPS
VARLFLGTGLPSVAGGPADPGAWDRWFGEMDSFTEGEGEVQARARKADALHPALATLYRE
VRAMRESHQVLPGRLEQISRAAASFPDDWLLKAEVEELRVLSPQEECVA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgacggaaagaacccttgcccgcttgccggcccatttgcgccgctatgtcgtg
ggacaggactacgcgtcgtacacgccccgggaccaagcggtgtggcgccacatcctccgc
cgcctgagccgtcacctgtcggacaaggcccacccggtctacctggaaggacttcaggcc
acgggcattggcgtggagcgcatccccagcctggacgagatgaacgagcggctggcccgg
ttgaactgggcggcggtgggggtgcgcggtttcatcccgcccgccgtcttcaccgagttg
cagtccatgagggtgctggccatcgcggccgacatccgcacacacgagcacatcccgtat
acccccgctccggacatcgtccacgagagcgcgggccacgcccccatcctcgcccacgcg
cgctatgccgagtacctccagcgcagcggcgtcgtcggcttcaagtccatcgccacggtg
gaggatcaggcggtgttcgaggccatccgccatctcagcgtggtgaaggaggacccgacc
tccacgcccgcggccgtcgagcacgcccaagcgcggctggaggcggcctcgcagagccgc
cgctacgtcagcgagagcacccaggcctcccggctctactggtggacggccgagtacggg
ctcgtgggcagcctggagcagcctcgcctgtatggcgctggcctgctgtcgagcatcggc
gaggcggagcactgcttcaccccggcggtgaagcgcgtcccgctgagcctggagtgtgtg
aggaccgactacgacatcacccgcatgcagccgcagctcttcgtcgcgcgggactttgaa
cacctcttcgaggtgctcgaggcgttcgaggccaccctgtcgtggaagcggggcggagac
tacggcttgcaagaggcccagcgcgcccgcacggtgaatcacctcgtgctctcggatggg
cgcgaaatcacaggccgcgtggtggagttgctgccgggcacgcggcccgtggcggaaggg
ctctccacggccctggtgtccctcgcgggtcccctcatgctctcccagaacgggaagtcc
ctcggcaagccctggcagagcctcaccctggtcgcctttggcgaggggaagttgccggaa
caggggccgttccagctcgagttggccagcggcttgcggttggagggcttcgccggcggc
gagggcgaggtgctccgcctgcgcgggtcgctgggcggccggccgctggagctgccctcg
gtggcgcggctgttcctcggcacggggctgccctcggtggcgggaggccccgcggatccc
ggcgcctgggaccggtggttcggagagatggactcctttaccgagggcgagggggaagtc
caggcacgcgcccgcaaggccgatgccctgcacccggcgctggccacgctctaccgtgag
gtccgcgccatgcgcgaatcccaccaggtcctgcctgggcggctggagcagatctcccgg
gccgccgccagcttccccgacgactggctgctgaaggccgaggtggaagagttgcgcgtc
ctgtcacctcaggaggagtgtgtcgcatga

DBGET integrated database retrieval system