KEGG   Stigmatella aurantiaca: STAUR_1815Help
Entry
STAUR_1815        CDS       T01425                                 

Definition
(GenBank) uncharacterized protein
  KO
K11891  type VI secretion system protein ImpL
Organism
sur  Stigmatella aurantiaca
Pathway
sur03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sur00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STAUR_1815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sur02044]
    STAUR_1815
Secretion system [BR:sur02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STAUR_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF_C ImcF-related_N AAA_16
Motif
Other DBs
NCBI-ProteinID: ADO69619
UniProt: E3FTK5
Position
2246576..2250430
Genome map
AA seq 1284 aa AA seqDB search
MGPQLLNGVGQALNVADPTKALEAAGKVLDAGAPPPEGASAPASEGFWLTVAPYLKWALI
ALLVALLVALLVFAGVKLYQWWRRRRSASAASSGPPPMASNRLLQVHRAFLSGLPLANRA
AVLDLPTVVVLGPAGSGKTLLIGLDVDWQRQARQFLPSHTSDSLLQVYLGPDCVVQELSA
PLLEDETLQARSALRRMWSKCFNRRQGGLAVLTLDIRWLAETPPDEQRRMAQLLRGKLNL
ISEACGGPVETRLCLTHMDGLEGFEDFARLLRQHGVARSFEIPKQGEESRLSTLLEGQEQ
YLALGLTSLPVDAFERLERFYSQGGRSFAALGRFVSSLLEGDTLSFKPRLTRVYLSSPTP
EARASGTLSVMSEEGSTLAPRSLYLRTHQRRAALIALVGCLPVLAAYANFYMLLGDAQEQ
VARFESTVAQMQEQGLEGRGEVVEEQVNEAADAISHLWSAARWWPPLNSSFPGEMLDVRQ
RLARGIRESHLRPTLEHCRKHPQDCRPEQVVYLLAALHASNKNGLGNFVNSSIQPRHSRR
WTGNQAGASKTAEVAASEQSRTWITALELREPLVATYVLASDEPWERNPPCRRGAAQVAH
SAETEWSCWPYAERLTVESQLKPWLDHLLFLRQALEAGPKGLAQLDQRREERERLEAQLA
DLDVYASLPTVLNLIDTAGIQSNTRHFQGIESTVQVLDWLRTNRDTLATVLDMEEEAYSG
LLAVEKMGPSELLTRDGLWLTGTKKGPYRIELLQQSFEFRPPQLSRELLQALLDAYEKSG
RLTMGPNEAIRPGQLILSRTPFETDLKPLVDDFTQRLKNVQLPTDESAKREEYVQKRVGV
FAQGYREGLFHSVRNYRFVAPRKALFDELARLTQPSSEQVDMLRDVALRASLDPLEGPYY
EPLRNAVAPFRPIVQLMVTDKSGFYAALAPYHALIAQMHDELDAGARRGQSKGGKAAGEA
PDKGKEAQAAGADAPAAGAGGEAGSAELVDMLTPLERVALSMLLEEEGSYLRKAQEWLDQ
QGISGELRQPFLEPFLQVQRLGKQELESTLSRQWEEASGRMLRSMLERYPFNPTSPQDVD
PGELEVLRRKDGAFWSFVNQMFSRVCVERGTQWSLRGPLREKLVLPEQMLLTLSRLSRLA
TLLWDEEGRSRPLMLKVQPQPLPTPPIPGVFVTMSSLKCGKTTAYGFNQIPTWQDFPVNW
WDQQVSSIVLELRSPARDAPQYVSLPWNRSAWSCFRLFEEAVLTTDQRRQWSLALQGNAG
DKRGLEISFGLKGEPWVPFREVPR
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
gtggggccgcagctgctgaacggggtgggacaggcgctgaacgtggcggatccaaccaag
gcgcttgaggcggccgggaaggtgctcgacgcgggggccccgccgccggaaggcgcgagc
gcaccggcgtccgaggggttctggctcacggtggccccctacctgaaatgggcgttgatc
gcgctcctcgtggcgctcctcgtggcgctcctcgtgttcgccggggtgaagctctatcag
tggtggcgccgccgccgctcggcttcggccgcatccagcggtcctccccccatggcgtcc
aaccgcctgctccaggtgcaccgggcttttctctccgggttgcccctggccaaccgggcc
gccgtgctggatttgcccaccgtggtggtgctcggccccgcgggcagcggcaagacgctg
ctcattggcctggatgtcgattggcagcgccaggcccggcaattcctccccagccacacg
tcggactcgctgttgcaggtgtacctgggcccagactgcgtggtgcaggagctctcggcc
ccgctgttggaagatgagacgcttcaagcccgcagcgctttgcgccggatgtggagcaag
tgtttcaaccgccgccagggggggctggccgtcctcacgctggacatccgctggctcgcg
gagaccccgccggatgagcagcggcgcatggcgcagctcctgcgtggcaagctgaacctc
atctccgaggcctgtggggggccggtggagacgcgcctgtgtctgacccacatggatggg
ttggagggcttcgaggatttcgcccggctgctgaggcagcatggtgtggcgagatccttc
gagattcccaagcagggtgaagagtcccgtctgtccacgctgctggaagggcaggagcag
tacctggccctggggctcacctcgttgccggtcgatgccttcgagcgcctggagcgcttc
tattcgcagggaggccgctcgttcgcggcgctgggccggttcgtctcctcgttgctggag
ggcgataccctctcgttcaagccgcgcctcacgcgcgtctacctgtcctctcccacgccc
gaggcgcgcgccagcggcacactgtcggtcatgtccgaggagggcagcaccctggcgccg
cgcagcctctacctgcgcacccaccagcgccgcgccgcgttgattgcgctggtgggctgt
ctgccggtgctggccgcgtatgcgaacttctacatgctgctgggcgatgcgcaggagcag
gtggcgcgcttcgagagcacggtcgcgcagatgcaggagcaggggctggaggggcgggga
gaggtcgtcgaggagcaggtgaacgaggcggcggatgccatcagccacttgtggagcgcg
gcccgctggtggccgcccctgaactccagcttcccaggagagatgctggatgtgcgccag
cggctggcccggggcatccgggagagccacctgcggcccaccctcgagcactgccgcaag
cacccccaggactgccgccccgagcaggtggtctacctgctggccgccctccacgcgtcg
aacaagaatgggctcggcaacttcgtgaactccagcattcagcctcggcactcgcggagg
tggaccggcaatcaggccggtgcctccaagacggcggaggtggctgcctccgagcagagc
cgtacctggatcaccgcgctggaattgcgcgagccgctcgtggcgacctacgtgctggcc
agcgacgagccctgggagcgcaatcccccgtgccgccggggggccgcgcaggtggctcat
agcgcggagaccgagtggtcctgctggccctatgcggagcggctgacggtcgagagtcag
ctcaagccctggttggatcacctgctgttcctccgccaagcgctggaggcgggccccaag
gggctggcccaactggatcagcggcgggaagagcgggagcggctggaggcacagctggcg
gatctcgatgtctatgcctcgctgcccacggtgctcaacttgattgacaccgcgggaatc
caatccaacacgcgtcacttccagggcatcgagtccacggttcaggtgctcgattggttg
cggacgaaccgggacaccctcgccacggtgttggacatggaggaagaggcctactcgggc
ctcctggccgtggagaagatgggcccctccgagttgctcacccgggatgggctctggctg
acgggcaccaagaaggggccgtaccggatcgagctgttgcagcagtctttcgagttccgt
cctccccagctgtcgcgggaactcttgcaagccctgctcgatgcctacgagaagagcggc
cggttgaccatggggcccaacgaggccatccgcccagggcagttgatcctgagccggacg
cccttcgagaccgatctcaagccgctcgtggatgacttcacccagcggttgaagaacgtc
cagctgccgaccgacgagtccgccaagcgcgaggagtatgtgcagaagcgggtgggcgtg
ttcgcccagggctaccgcgaggggctcttccacagcgttcgcaactaccgtttcgtcgcg
ccgcgcaaggcgctgttcgacgagctggcgcggctcacccaaccctcgtccgagcaggtg
gacatgctgcgcgacgtggccctccgggccagtctggatccgctggaggggccctactac
gagccgctgcgcaacgcggtggcccccttccggcccatcgtccagctcatggtcaccgac
aagagcggcttctatgccgcgctggccccgtaccacgccttgattgcccagatgcacgat
gagctggacgcgggggccaggcgcggccagtccaaggggggcaaggccgcgggggaggct
ccggacaagggcaaagaggctcaggcggctggagcagacgcccctgccgcaggcgctgga
ggcgaagcggggtccgcggaactcgtggacatgctcacgccgctggagcgggtggcgctc
tcgatgctcctcgaggaggagggctcctacctgcgcaaggcgcaggagtggctggatcag
cagggcatctcgggagagttgcggcagccttttctcgaacccttcttgcaggtgcagcgc
ctgggcaagcaagagctggagagcaccctgtcgcggcagtgggaggaggcctccggacgc
atgctgcgctccatgttggagcgttatcctttcaaccccacctctccgcaggacgtggat
cccggcgaactggaggtgctgcgccgcaaggatggcgccttctggagcttcgtgaaccag
atgttctcccgggtgtgcgtggagcgcggaacccagtggtctctgcgagggcccttgcgc
gagaagctggtgctgcccgagcagatgctgctgacgctcagccggttgtcccggctggcg
acgctgttgtgggacgaggagggccgctcccggccgttgatgttgaaggtgcagccccag
cctctgcccacgccgccgatcccaggcgtcttcgtcaccatgtcctcgctcaagtgcggg
aagacgaccgcctacggcttcaatcagattcccacctggcaggatttccccgtgaactgg
tgggatcagcaggtatcctcgattgtcctggagctgcgctcccccgcgcgggatgccccc
cagtacgtgtccttgccctggaatcgctcggcctggagctgcttccgcttgttcgaggag
gcggtgctcaccacggaccagcgccgtcagtggagccttgcattgcaggggaatgccgga
gacaaacgcgggctggagatcagctttgggctcaagggtgagccctgggttcctttccgg
gaggtgccgcggtga

DBGET integrated database retrieval system