KEGG   Stigmatella aurantiaca: STAUR_1918Help
Entry
STAUR_1918        CDS       T01425                                 

Definition
(GenBank) Ribose transport ATP-binding protein RbsA
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
sur  Stigmatella aurantiaca
Pathway
sur02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sur00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STAUR_1918
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sur02000]
    STAUR_1918
Enzymes [BR:sur01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     STAUR_1918
Transporters [BR:sur02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    STAUR_1918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 Zeta_toxin RsgA_GTPase AAA_30 AAA_27 AAA_23 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ADO69722
UniProt: E3FV84
Position
complement(2373222..2374775)
Genome map
AA seq 517 aa AA seqDB search
MSEAVPVLEMKGISKRFSGVQALRGVDFRLFPGEVHSVMGQNGAGKSTLIKVLTGVHRPD
AGRILLQGREVKPKSPLEAQRLGISTVYQEVNLCPNLSVAENICLGHNGSESFAIRWKQM
HQRAESLLSDLNLHVDVSAPLFTCSIAVQQVCAIARALNMQAKILILDEPTSSLAEDEVK
MLLSVMRRLKAQGMAILFVTHFLGQTFEISDRITILRNGELVSEHPVNGVSRMELVNKMV
GREVSSEGTSRTQSARAPLPLEPKAAGDGERSGTRKPFLRAEKLGRRGSVQDVELEVQQG
QSLGMGGLLGSGRTELARLLFGIDRAEQGSIEIEGEPARLSSPMEAIQRGIGFCPEDRKH
EGIIGELSIRENMVLALQAKSGIFRSISRKQQEELAERYIQALGIKVSDMETPISQLSGG
NQQKVLLARWLATHPRMLILDEPTRGIDVAAKAEIMGQVMALCDQGMAILFISSEIEEVL
RYSDRIAVMRDRQKVGELETREADEGSVFKIIAGGQA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagccgttccggtgctcgagatgaaggggatctcgaagcgcttctccggtgtc
caggccctccgtggcgtcgacttccgtctcttcccgggcgaggtccactcggtgatgggc
cagaatggcgcgggaaagtcgacgctgatcaaggtcctgaccggcgtccatcgcccggac
gcaggccgcatcctccttcagggccgcgaggtcaaacccaagagccccctggaggcgcag
cggctgggaatcagcacggtctaccaagaggtgaacctctgccccaacctctcggtcgcc
gagaacatctgcctgggccacaacggctccgagtccttcgccatccgctggaaacagatg
caccagagggcggagtctctcctgtcggacctcaacctccacgtcgatgtcagcgcgccc
ctgttcacctgctcgatcgcggtccagcaggtgtgcgccatcgcccgggcgctgaacatg
caggcgaagatcctcatcctcgacgagcccacttcgagcctcgccgaggacgaggtgaag
atgctcttgtccgtcatgcggaggctcaaggcccaggggatggccatcctcttcgtcacg
cacttcctcggccagaccttcgagatctccgaccgcatcaccattctgagaaacggcgag
ctcgtcagcgagcatcccgtgaatggcgtgtcccgcatggagttggtgaacaagatggtc
ggccgcgaagtctccagcgaagggacgagcaggacccagagcgcccgcgcccccctcccg
ctggagcccaaggcagcgggtgacggggagcgctcggggaccaggaagcctttcctgcgc
gcggagaagctcggccgccggggctcggttcaggacgtggaactggaggtccagcaaggc
caatccctgggcatgggaggccttctgggctcgggaagaaccgagctggcccggctgctc
ttcggcatcgaccgggccgagcagggctcgatcgaaatcgaaggagaaccggcgcggctc
tcctcgccgatggaggccatccagcgaggcatcggcttctgtccagaggaccgcaagcac
gaaggcatcatcggagagttgtcgatccgcgagaacatggtgctcgcgctccaggcgaag
tcgggcattttccggagcatctcccggaagcagcaggaggagctggcggagcgctacatc
caggccctgggcatcaaggtctccgacatggagacgcccatctcccagctctccggcggc
aatcagcagaaggtgctcctggcacgctggctggccacccatccgcggatgctcatcctc
gatgagcccacccggggcatcgacgtcgcggcgaaggccgagatcatgggacaggtgatg
gcattgtgtgaccagggcatggccatcctcttcatctcctcggagatcgaagaggttctc
cgctattcggaccgcatcgcggtcatgcgcgaccgccagaaggtgggcgagctcgaaacc
cgtgaggcggacgagggcagcgtgttcaagatcatcgcgggaggccaggcatga

DBGET integrated database retrieval system