KEGG   Stigmatella aurantiaca: STAUR_2126Help
Entry
STAUR_2126        CDS       T01425                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00010  Glycolysis / Gluconeogenesis
sur00071  Fatty acid degradation
sur00350  Tyrosine metabolism
sur00625  Chloroalkane and chloroalkene degradation
sur00626  Naphthalene degradation
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01130  Biosynthesis of antibiotics
sur01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_2126
  Lipid metabolism
   00071 Fatty acid degradation
    STAUR_2126
  Amino acid metabolism
   00350 Tyrosine metabolism
    STAUR_2126
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STAUR_2126
   00626 Naphthalene degradation
    STAUR_2126
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STAUR_2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N Sacchrp_dh_NADP Glu_dehyd_C Methyltransf_25 Methyltransf_11 2-Hacid_dh_C NADH_4Fe-4S ThiF
Motif
Other DBs
NCBI-ProteinID: ADO69930
UniProt: E3FZR5
Position
complement(2619882..2620928)
Genome map
AA seq 348 aa AA seqDB search
MQTKAYQLIAWQQPPELRAVDVREPGPGEVLIKVGGAGTCRTDLNLMGMPAGAMPYTLPF
TLGHETAGWVEALGAGVTGLERGEPVLVYGPWGCGRCGPCRQGAENHCERVFELRSHGGG
VGRDGGLAHYLLVPSSRLLVPLGSLDPRDAAPLTDAALTPYHAIKKALPLLVPGSTAVVI
GAGGLGQMALQLLSALSPTRVIAVDASPEKLARARELGVPDAVLADTQTAAHLRELTHGR
GAELVLDLVGTNETLALAAQALRPRGQLTLVGLSGGVLPFHFFALPLECQVVAPYWGTLP
ELMEVLALAEAGRLRMTVERFPLERVAEAYQRMREGTLKGRAVITPHG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaacgaaggcttatcaactcatcgcgtggcagcaaccaccggaactgcgagcggtc
gacgtccgggaacctgggcccggtgaggtgctcatcaaggtgggcggtgcgggcacgtgc
cgcacggacctcaacctcatgggcatgcccgcgggcgccatgccttacaccttgcccttc
accttgggccacgaaaccgcggggtgggtggaggccttgggagccggtgtcacgggcctg
gagcggggcgagccggtgctcgtctatggcccgtggggctgcgggcgctgcggcccctgc
cggcagggggcggagaaccactgtgagcgggtcttcgagctgcgctcacatggagggggc
gtgggccgggatggaggcctggcccactacctgctcgtcccctcctcgcgcctgctcgtg
ccgctgggctccctggatccccgcgacgccgcgcccctgacggatgcggccctgacgccc
taccacgccatcaagaaggccctcccgctgctcgtgccgggctccacggccgtggtcatc
ggcgccggggggctggggcagatggccctccagttgctgagcgcgctgagccccacgcgg
gtcatcgccgtggatgcgtccccggagaaactcgcccgggcccgggaactgggcgtcccc
gacgcggtcctcgcggacacgcaaaccgccgcccacctccgggagctgacccacggacgc
ggcgcggagctcgtgctggacctggtgggcaccaacgagaccctggcgctggcggcccag
gccctgaggccgcgcgggcagctcacgttggtggggctcagcgggggcgtcctgcccttt
cacttcttcgccctgccgctggagtgccaggtggtcgccccctactggggcaccctgccc
gagctgatggaagtgctcgccctggcggaggcgggccgcctgcgcatgacggtggagcgc
ttcccgctggagcgggtcgcggaggcctaccagcgcatgcgggaagggaccctgaagggc
cgcgccgtcatcaccccccacgggtga

DBGET integrated database retrieval system