KEGG   Stigmatella aurantiaca: STAUR_2311Help
Entry
STAUR_2311        CDS       T01425                                 

Gene name
apaG
Definition
(GenBank) ApaG protein affecting Mg2+/Co2+ transport
  KO
K06195  ApaG protein
Organism
sur  Stigmatella aurantiaca
Brite
KEGG Orthology (KO) [BR:sur00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    STAUR_2311 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ADO70115
UniProt: E3FDN6
Position
2843448..2843831
Genome map
AA seq 127 aa AA seqDB search
MSTTTTEGIRITVKPAYWPERSAPESGHYAFMYTVEIANVGNLPAQLRSRHWVITDAHGR
IEEVRGEGVVGKQPRLEPGERFEYTSWAMLRTAFGSMRGSYALVRPNGLQFDAQIGEFAL
TLPNALH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgacgaccaccgagggcatccggatcaccgtgaagcccgcctattggcccgag
cgcagcgcccccgagtccgggcactacgcgttcatgtacacggtggagatcgccaatgtg
gggaacctccccgcccagctgcgcagccgccactgggtcatcaccgacgcccatgggcgc
atcgaagaagtccggggagagggcgtggtgggcaagcagcctcgcctggagcccggtgag
cgcttcgagtacacgagctgggccatgctgcgcaccgcgttcggctccatgcggggcagc
tacgccttggtccgcccgaatggattgcagttcgacgcccagattggcgagttcgctttg
accttgcccaacgcgttgcattga

DBGET integrated database retrieval system