KEGG   Stigmatella aurantiaca: STAUR_2351Help
Entry
STAUR_2351        CDS       T01425                                 

Definition
(GenBank) Peptidase M49 family protein, dipeptidyl-peptidase III
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
sur  Stigmatella aurantiaca
Brite
KEGG Orthology (KO) [BR:sur00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sur01002]
    STAUR_2351
Enzymes [BR:sur01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     STAUR_2351
Peptidases [BR:sur01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   STAUR_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-ProteinID: ADO70155
UniProt: Q08U85
Position
2904649..2906778
Genome map
AA seq 709 aa AA seqDB search
MNALLLVVALAAAPQAKAPPPAASAPLAASDFLKSRSKTTAVAQLFAPGVANLTADEKRV
LWNLTLAAHAGQDIAYDQLGWRLVAVKRLLENVYLFGKEGQGGPGLFDKRLTAYLERFYG
HMGNHDHVTGQKFVPEFTAGELDAAAVRAFRAGASFGVKDEVALRGWLAGLRPTIFDASF
EPSLTSKSPPPGQDMVTASANTAYGPGVTRADLEEFKEKYPLNSRVVKENGKLVELVFRS
GAQKIPPGLYAVELGRVVDHLEEAMKSAPKDQKAVLGKLARYFQTGNPKDWEAFNIAWVK
ANPRVDATLGFVETYVDPLGQKGLWEGLVNYRDPQENRVMELIGKRAQYFEERMPWPQAY
KRKRVSLPVAKAIHLVATYPQPPAGINLPNEQHIREKYGSKSVLVANVMEVASALRRLPL
AVEFSRTEEDRAQARKHSATARKWLVAFHEVLGHASGQVDKKLGKQPPSRFLKEYDNTLE
EARADLVALWHAFDPALAELSPEHEQIAQQMYRDFLVEGLTNLQRVEKGDEFEEDHQRGH
HMTVNFLIEKGVVRQTVEGGRTYWGVVDFAKMREAVGELLSKLMVIKATGDYAGIRALVT
QKGIKFDPKLRDEVVARVKAADVPSVIFVTAPRLIPVLDDRRRVVDVKVESTQGFIEQNL
ERSLLGRLPPAEATQAAVRLASAPEALKEMYRKLLQVPGELPAVAPAVP
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgccctcctcttggtcgtcgcgcttgccgccgctccacaggcgaaggcgccccct
cccgccgccagtgctcccctggcggcgagtgattttctcaagtcgcgctccaagaccacc
gccgtcgcgcagctcttcgcgcctggggtggcgaatctgacggcggacgagaagcgcgtc
ctctggaatctgacgctcgcggcgcatgcgggccaggacatcgcctacgaccagctgggc
tggaggctggtggccgtcaagcgcctcctggagaacgtgtacctctttggcaaggagggg
cagggcggcccgggcctgttcgacaagcggctgacggcctatctggagcgcttctacggg
cacatgggcaaccatgaccatgtgacgggccagaagttcgttccggagttcaccgcgggg
gagttggacgccgcggccgtgcgcgccttccgcgccggcgcatccttcggggtgaaggac
gaggtggcgctgagagggtggctcgcgggcttgcggccgacgatcttcgatgcctccttc
gagccctccctcacgtccaagtcgcccccgccgggccaggacatggtcaccgcgtcggcg
aataccgcctacgggcctggggtcactcgggcggacctggaggagttcaaggagaagtac
ccgctcaactcccgggtggtgaaggagaacggcaagctggtggagctggtcttccgctcc
ggggcacagaagatccctccggggctgtacgcggtggagctgggccgtgtcgtcgatcac
ctggaagaggcgatgaagtcggcccccaaggaccagaaggccgtgttgggcaagctggcg
cgctatttccagacgggaaacccgaaggattgggaggccttcaacatcgcctgggtgaag
gccaatccccgggtggatgccaccctcggcttcgtcgagacgtacgtggatccgctgggc
cagaaaggcctgtgggaagggctcgtcaactaccgggatccgcaggagaaccgggtgatg
gagctcatcggcaagcgggcgcagtacttcgaggagcggatgccctggcctcaggcctac
aagcgcaagagggtgtcactgccggtggccaaggccattcacctggtggccacctacccg
cagccgcccgcgggcatcaacctgcccaacgagcagcacatccgcgagaagtacggcagc
aagagcgtgctcgtggccaatgtgatggaggtggcctccgcgctgcgaaggttgccgctg
gcggtcgaattctcccggacggaagaggatcgcgcccaggcccgcaagcactccgccacg
gcgcgcaagtggctggtggcctttcacgaggtgcttggccatgcctccggccaggtggac
aagaagctgggaaagcagccgccctcgcgcttcctgaaggagtacgacaacaccctggag
gaagcgcgggcggacctggtggcgctctggcatgcctttgatccggccctcgcggagctg
tctccggagcacgagcagatcgcccagcagatgtaccgcgactttctcgtcgaggggctt
accaacctgcagcgcgtggagaagggcgacgagttcgaggaggaccaccagcgcggccac
cacatgaccgtgaacttcctgatcgagaagggggtcgtgcggcagacggtggaagggggc
cgcacctattggggggtggtggacttcgcgaagatgcgcgaagcggtcggtgaactgctc
tcgaagctgatggtcatcaaggccaccggggattacgcgggcatccgcgccctggtgacg
cagaagggcatcaagttcgatccgaagctccgggatgaagtcgtcgcgcgggtgaaggcc
gccgatgtgccttcggtcatcttcgtcaccgcgccgcgcctcattcccgtcctcgatgac
aggcgcagggtggtggacgtgaaggtggaatccacacagggtttcatcgagcagaacctc
gaacgcagcctgctcggaaggctcccgcccgcggaggccactcaggcggcggtgcggttg
gccagtgcgccggaggcattgaaggagatgtatcgcaagctcctacaggttcccggagag
ctacccgcagtggctcccgccgtaccctga

DBGET integrated database retrieval system