KEGG   Stigmatella aurantiaca: STAUR_2696Help
Entry
STAUR_2696        CDS       T01425                                 

Gene name
recR
Definition
(GenBank) Recombination protein
  KO
K06187  recombination protein RecR
Organism
sur  Stigmatella aurantiaca
Pathway
sur03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sur00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    STAUR_2696 (recR)
DNA repair and recombination proteins [BR:sur03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     STAUR_2696 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      STAUR_2696 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH Toprim_2 HHH_8 IMS_HHH HHH_3 Prok-RING_4 NOB1_Zn_bind
Motif
Other DBs
NCBI-ProteinID: ADO70499
UniProt: E3FKY1
Position
complement(3279157..3279750)
Genome map
AA seq 197 aa AA seqDB search
MTPDPLNRLVAQLAKLPGIGEKTAQRLAFHILRAPSEYAVDLSQAIREVKEKVHLCTRCF
SLTDTELCGFCRDSRRDERVLCVVETFADLMALERTREFKGRYHVLHGVLSPLEGIGPDQ
LRIRELLERLADSKVEEIILATNPDVEGEATSLYLMRLLKPLGLRVSRIAQGLPMGGDLE
YADQATLAKALSARREL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatcccctcaatcgcctggtggcccagctcgcgaagcttccgggcatcggc
gagaagaccgcgcagcgcctcgcgtttcacatcctgcgggctcccagcgagtacgccgtg
gacctgtcccaggccatccgcgaggtgaaggagaaggtgcacctgtgcacccgctgcttc
tcgctcacggacacggagctgtgcggcttctgccgtgacagccgccgggacgagcgcgtg
ctgtgcgtcgtggagaccttcgcggacctgatggccctggagcgcacgcgcgagttcaag
ggccgctaccatgtgctgcacggcgtgctgtcgccgctggagggcatcggcccagaccag
ctgcgcatccgggagctgctggagcggctggccgacagcaaggtggaggagatcatcctc
gccaccaacccggacgtggagggcgaggccacctcgctctacctgatgcgcctgctcaag
cccctgggcttgcgcgtcagccgcatcgcccagggcctgcccatgggcggcgatctcgag
tacgccgaccaggcgaccttggccaaggcgctcagcgcccggcgcgagctgtag

DBGET integrated database retrieval system