KEGG   Stigmatella aurantiaca: STAUR_3742Help
Entry
STAUR_3742        CDS       T01425                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sur  Stigmatella aurantiaca
Pathway
sur03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sur00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    STAUR_3742 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sur03011]
    STAUR_3742 (rplV)
Ribosome [BR:sur03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    STAUR_3742 (rplV)
  Bacteria
    STAUR_3742 (rplV)
  Archaea
    STAUR_3742 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADO71530
UniProt: Q08ZJ3
Position
4497104..4497448
Genome map
AA seq 114 aa AA seqDB search
MDSTAHLRHVRMSPRKLSLVAALVRGKSVEAALHILKFTPRAASAPVAKLIKSAVANATD
KSKGQVDVDTLYVKTISVDQGPTQRRYMPRAMGRATPINKKSSHVHVVLSEAKK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggattccactgcacacctgcggcacgtccgcatgtctccccggaagctctcgctggtg
gcggcgctcgtccgcggtaagtcggtcgaggcggccctccacatcctgaagttcaccccc
cgcgcggcctcggccccggtggccaagctcatcaagagcgccgtggccaacgcgaccgac
aagtccaagggtcaggttgacgtggacacgctctacgtgaagaccatctccgtggaccag
gggcccacccagcgccggtatatgccgcgcgccatgggccgcgcgacccccatcaacaag
aagagcagccacgttcacgtggttctgtccgaggcgaagaagtag

DBGET integrated database retrieval system