KEGG   Stigmatella aurantiaca: STAUR_3896Help
Entry
STAUR_3896        CDS       T01425                                 

Definition
(GenBank) Pseudouridine synthase, RluA family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sur  Stigmatella aurantiaca
Brite
KEGG Orthology (KO) [BR:sur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sur03009]
    STAUR_3896
Enzymes [BR:sur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     STAUR_3896
Ribosome biogenesis [BR:sur03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    STAUR_3896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ADO71684
UniProt: Q091A2
Position
complement(4670103..4670999)
Genome map
AA seq 298 aa AA seqDB search
MAFNTGYAYREQLGVRARGQSTLSYLVASYRHSPEPVWRERLARGEVLLDDLPATGEELL
KPGQRLVWNRPPWEEKETPRDYTLVYADEAILAVDKPGGLPTMPGGGFLVNTLLHVVRER
FPEVSPLHRLGRGTSGLVLFARTHDAAAKLSRAWREHEVEKRYRALSSHVASQDAYDITA
PIGEAVHPGRGLLSMALPSGKASRSLARVLQRRAASTLFEVDIQTGRSQQIRIHLAFIGH
PLEGDPVYTVGGVPRAEQPGLLGDTGYLLHAERLCFVHPLTGERLELHATLPSELLVK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaacacgggctatgcctaccgcgaacaactcggtgtccgggcccgaggacag
agcacgctctcctatctggtcgcctcctaccggcactctccggagccggtgtggcgggag
cggctcgcgcgaggcgaagtcctgttggatgacctgcccgcgacgggcgaggagcttctg
aaacccggccagaggctcgtctggaaccggcccccctgggaggagaaggagacgccgcgc
gactacacgctcgtgtatgcggacgaggcaatcctcgcggtcgacaagccgggcggactg
cccacgatgccggggggtggcttcctcgtgaacaccctgctccacgtcgtgcgggagcgc
ttcccggaggtgagccccctgcaccggctggggcgcggcacctcgggcctcgtgctcttc
gcgcgcacgcacgacgcggcggcgaagctgtccagggcctggagagaacacgaggtggag
aagcgctaccgggccctgtcgagccacgtggcctcccaggatgcctacgacatcaccgcg
cccatcggcgaggcggtgcatccggggcggggcctgctctccatggcgctccccagcggc
aaggcgtcccggagtctggcgcgcgtgctccagcggcgcgcggcgagtaccctcttcgag
gtggatatccagacaggccgctcgcagcagatccgcatccacctggccttcatcgggcac
ccgctcgagggagatcccgtctacaccgtgggaggtgtcccgcgcgccgagcagccggga
ctgctcggggacacgggttatctgctacacgcggagaggctttgcttcgtacatcccctc
acgggcgagcgcctggaattgcacgccacccttccgagtgaactcctggtgaagtag

DBGET integrated database retrieval system