KEGG   Stigmatella aurantiaca: STAUR_4031Help
Entry
STAUR_4031        CDS       T01425                                 

Gene name
pyrB
Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00240  Pyrimidine metabolism
sur00250  Alanine, aspartate and glutamate metabolism
sur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    STAUR_4031 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STAUR_4031 (pyrB)
Enzymes [BR:sur01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     STAUR_4031 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADO71817
UniProt: E3FMN6
Position
4885184..4886074
Genome map
AA seq 296 aa AA seqDB search
MRHLLGIEGWRREEIEALLDRAEAHLPGGSASSSVLQGRVVANVFFEDSTRTRTSFEMAA
KTLGAEVLNWTAQGSSISKGETLLDTVRNIEATGPVALVIRHRSSGAPHLAARHVRCAVI
NAGDGTHEHPSQALLDAFTLRRRWGALDGRTVLIVGDILHSRVARSNILCMKALGARVVV
CGPPTLLPVGIQQLGTEVAMHLDPVLPQADAVMCLRLQTERQSESFFPSTREFSRLYGLN
AQRASKMKEGALVMHPGPINRGVELAPAVADGARSVILEQVANGVAVRRAILEVCV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagacaccttctcggaatcgaaggctggcggcgcgaggaaatcgaagcgctgctcgac
cgggccgaagcgcacctgccgggtggctcggcaagctcctccgtcctccagggacgggtg
gtggccaacgtcttcttcgaggactccacccggacccgcacctctttcgagatggccgcc
aagacgctgggcgccgaggtgctcaactggacggcgcaaggctcgtcgatctccaagggc
gagacactgctggacaccgtgcgcaacatcgaggccaccggcccggtggccctcgtcatc
cggcaccgctcctcgggggcgccccatctggcggcgcgccacgtgcgctgcgccgtcatc
aacgctggggatggcacccacgagcatccctcgcaggccctgctggatgccttcaccttg
aggcgccgctggggcgcgctggatgggcgcaccgtgctcatcgtgggcgacatcctccac
agccgcgtggcgcgctccaacatcctgtgcatgaaggcgctcggggcgcgcgtggtggtc
tgtgggccccccacgctgctgcccgtggggatccagcagttgggcaccgaggtggcgatg
cacctggatccggtgctgccccaggcggatgcggtgatgtgcctgcgccttcagacggag
cggcagtccgagtctttcttcccctccacccgcgagttctcccgcctctatgggctcaac
gcgcagcgggccagcaagatgaaagagggggcgctcgtcatgcacccgggccccatcaac
cgcggggtggagctggccccggccgtggcggatggggcgcgcagcgtcatcctcgagcag
gtggccaacggggtcgccgtgcgccgggccatcctggaggtatgcgtgtga

DBGET integrated database retrieval system