KEGG   Stigmatella aurantiaca: STAUR_4335Help
Entry
STAUR_4335        CDS       T01425                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00071  Fatty acid degradation
sur00072  Synthesis and degradation of ketone bodies
sur00280  Valine, leucine and isoleucine degradation
sur00310  Lysine degradation
sur00362  Benzoate degradation
sur00380  Tryptophan metabolism
sur00620  Pyruvate metabolism
sur00630  Glyoxylate and dicarboxylate metabolism
sur00640  Propanoate metabolism
sur00650  Butanoate metabolism
sur00900  Terpenoid backbone biosynthesis
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01130  Biosynthesis of antibiotics
sur01200  Carbon metabolism
sur01212  Fatty acid metabolism
sur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STAUR_4335
   00630 Glyoxylate and dicarboxylate metabolism
    STAUR_4335
   00640 Propanoate metabolism
    STAUR_4335
   00650 Butanoate metabolism
    STAUR_4335
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STAUR_4335
   00072 Synthesis and degradation of ketone bodies
    STAUR_4335
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STAUR_4335
   00310 Lysine degradation
    STAUR_4335
   00380 Tryptophan metabolism
    STAUR_4335
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STAUR_4335
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STAUR_4335
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STAUR_4335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sur04147]
    STAUR_4335
Enzymes [BR:sur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STAUR_4335
Exosome [BR:sur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STAUR_4335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADO72115
UniProt: Q08PZ3
Position
complement(5284349..5285530)
Genome map
AA seq 393 aa AA seqDB search
MARTVVIVGAARTPIGAFQGALSKLTAPQLGAVAIKAALERAGVKPEAVQEVLMGCVLQA
GIGQAPARQALRLSGIPDTVPATTVNKVCGSGLKAVVAGAQAIALGDADVVVVGGMESMS
NAPYISHSLRGGARMGNVEFKDAMIHDGLWDPYDNVHMGSCAEECAVSQGISRSQQDEYA
LESTQRAIKAQKEGLFTSEIVPVPVPGKKPEDTVIVTEDEGPRNAKPEKIATLKPVFKKD
GTVTAANASSINDGAAALVLMSEERAKAEGRTILGRITGYAEAARKPVEFTIAPADAIHK
LLTKQGLKADAVDLWEINEAFAVVAIANNRLLKLDPSKVNVRGGAVVLGHPIGASGARLL
VTLLHTLKDQDKKRGVASLCIGGGEGIALMVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaacagtcgtcatcgtgggcgcggcccgtactcccatcggggcttttcagggt
gccctctccaagctcacggcgccccagctcggcgcggtggccatcaaggcggccctggag
cgcgctggcgtcaagcccgaggccgtccaggaagtcctcatgggctgcgtgttgcaggcc
ggcatcggccaggcccccgcgcgccaggccctgcggctgtcgggcatcccggacaccgtg
cccgccaccaccgtgaacaaggtgtgtggctccgggctcaaggcggtcgtcgccggggcc
caggccatcgcgctgggagacgcggacgtggtggtggtgggcggcatggagtccatgagc
aatgcgccctacatcagccactcgctgcggggcggcgcccgcatgggcaacgtggagttc
aaggacgcgatgatccacgacgggttgtgggatccgtacgacaacgtccacatgggcagc
tgcgccgaggagtgcgcggtgtcgcagggcatcagccgctcccagcaagacgagtacgcg
ctcgagtccacccagcgcgccatcaaggcccagaaagaagggctgttcacctcggagatc
gtcccggtgcccgtgccgggcaagaagcccgaggacaccgtcatcgtcaccgaggacgag
gggccccgcaacgccaagccggagaagatcgccaccctcaagcccgtcttcaagaaggac
ggcacggtgacggccgccaacgcctcctccatcaacgatggcgccgcggcgctggtgctg
atgagcgaggagcgcgccaaggccgagggccgcaccatcctgggccgcatcaccggctac
gccgaggcggcgcgcaagccggtggagttcaccatcgccccggcggacgccatccacaag
ctgctcaccaagcagggcctgaaggccgacgcggtggacctctgggagatcaacgaggcg
ttcgcggtggtggccatcgccaacaaccgcctgctcaagctcgacccgtccaaggtgaac
gtgcgcggcggcgcggtggtgctcggccaccccatcggggcctcgggcgcgcgcctgctg
gtgacgctgctgcacacgctgaaggaccaggacaagaagcgcggcgtcgcctcgctgtgc
atcggtggcggcgagggcattgccctcatggtcgagcggtga

DBGET integrated database retrieval system