KEGG   Stigmatella aurantiaca: STAUR_5137Help
Entry
STAUR_5137        CDS       T01425                                 

Definition
(GenBank) 6-phosphofructokinase, pyrophosphate-dependent
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00010  Glycolysis / Gluconeogenesis
sur00030  Pentose phosphate pathway
sur00051  Fructose and mannose metabolism
sur00052  Galactose metabolism
sur00680  Methane metabolism
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_5137
   00030 Pentose phosphate pathway
    STAUR_5137
   00051 Fructose and mannose metabolism
    STAUR_5137
   00052 Galactose metabolism
    STAUR_5137
  Energy metabolism
   00680 Methane metabolism
    STAUR_5137
Enzymes [BR:sur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STAUR_5137
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     STAUR_5137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat DUF1652 FAD_binding_6
Motif
Other DBs
NCBI-ProteinID: ADO72909
UniProt: Q08ST9
Position
complement(6330875..6332305)
Genome map
AA seq 476 aa AA seqDB search
MPYLYKHCYICQTPSGLGGEILKIPQVFADSPPSSGQDAANPFEAGDMKKLAIVVAGGPA
PGINSVIGAATIRACLSGVEVLGIQDGFKWLSEGDISRVVPLTIADTSRIHFRGGSHIGI
SRANPTRSPEHLQRTIDAMERLGVGMLITIGGDGTATLAQIISEKTRGKIRVVHVPKTID
NDIDLPHDTSTFGFQTARHVGVDIVKNLMVDAKTTSRWYFVVAQGRKAGHLALSIGKAVG
ATVTLIPEEFRGKKVPFATVVDILTGSVLKRLAYGRPDGIALLAEGLADCIIPEDLAKYT
ELPRDHMGNLHVADIQLGEVLEKGVKERLAGLGLKATLIPKYIGYEVRCADPIPFDMEYT
RDLGHCAARYIIQGGTEAVVAIINGQFQPLSFQTMKNPDTGMPRVRLVDVDSDRYQIARG
FMLRLKREDFNKPEELARLATTTHLTPEAFRDQFFHLVKDEPEVTPDAGLKLMTQQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatttgtataagcactgttatatctgtcaaaccccctctgggctgggcggagag
atcctcaagattcctcaggtttttgctgattcccccccctcctcgggccaggatgcggcg
aaccccttcgaggctggagacatgaagaagctcgccatcgtcgtcgctggaggacctgct
ccaggcatcaacagtgtcatcggagcggccaccatccgggcctgtctctcgggggtggag
gtgcttggcatccaggatggattcaagtggctctccgagggggacatctcccgggtggtg
ccgctcaccatcgcggacaccagccgcatccacttccggggcggctcgcacattggcatc
tcccgcgccaaccccacccgctctcccgagcacctccagcggacgattgacgccatggag
cggttgggcgtgggcatgctcatcaccatcggtggtgatggcaccgcgacgctggcgcag
attatctcggagaagacccgggggaagatccgggtggtccacgttcccaagacgatcgac
aacgacatcgatctgccccacgacacgagcaccttcgggttccagaccgcgcgtcacgtc
ggcgtggacatcgtgaagaacctcatggtcgacgcgaagaccacctcgcgctggtacttc
gtcgtcgctcagggccgcaaggcgggccacctcgcgctgtcgatcggcaaggcggtgggg
gccaccgtcaccctcatccccgaggagttccgcggcaagaaggtccccttcgccaccgtc
gtcgacatcctgacgggctcggtcctcaagcggctggcgtacgggcggccggatggcatc
gcgctgctggccgaggggctcgccgactgcatcatccccgaggatctggccaagtacacg
gagctgccgagggaccacatgggcaacctccacgtggcggacatccagctgggggaggtg
ctggagaagggggtgaaggagcggctcgcggggctgggcctcaaggccacgctcattccg
aagtacatcggctacgaggtgcgctgcgccgaccccattcccttcgacatggaatacacg
cgagacctggggcactgcgcggcccgctacatcatccagggaggcaccgaggcggtggtg
gccatcatcaacggccagttccagcccctgtccttccagacgatgaagaacccggacacg
ggaatgccccgggtgcggctggtggacgtggactccgatcgctaccagatcgcccggggg
ttcatgctccgcctcaagcgcgaggacttcaacaagcccgaggaactggcccgcctcgcc
acgacgacccacctcacgcccgaggcgttccgggaccagttcttccacctggtgaaagac
gagcccgaggtcaccccggatgcgggcctgaagctgatgacccagcagtag

DBGET integrated database retrieval system