KEGG   Stigmatella aurantiaca: STAUR_5556Help
Entry
STAUR_5556        CDS       T01425                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00230  Purine metabolism
sur01100  Metabolic pathways
Module
sur_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    STAUR_5556 (gmk)
Enzymes [BR:sur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     STAUR_5556 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_22 AAA_18 MMR_HSR1 TsaE NTPase_1 IPPT AAA RNA_helicase KAP_NTPase AAA_25 cobW
Motif
Other DBs
NCBI-ProteinID: ADO73321
UniProt: Q08WN1
Position
complement(6871768..6872412)
Genome map
AA seq 214 aa AA seqDB search
MNESTLHPELLLVLSAPSGAGKTTLAHRLLKEVPNALFSASFTTRRPRGKEQDGVDYHFV
DVATFQEKIERSEFVEWAEVHGHFYGSPQSVVEEARARRGVAIFDIDVQGGQAIKRKHPE
AVLIFVLPPSMEELERRLRDRKTDSDETIRRRMLAARSEIERGIASYDYIVLNDDFERAF
QELRSVVIAERCRRGRVDLSKLKLEKPPASDAGR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatccacccttcatccagaattgctgctggtgctctccgcgccctccggggcg
ggaaagaccacgctggcgcaccggctcctcaaggaagttccgaacgcgctcttctcggcc
agtttcacgacgcgtcgtccccggggaaaggagcaggacggggtcgattaccacttcgtc
gacgtcgccaccttccaggagaagatcgagcggagcgagttcgtcgagtgggccgaggtt
cacggtcacttctatggcagtccccagtccgtggtggaggaggcgagggctcgccggggc
gtcgccatcttcgacatcgacgtccagggcgggcaggcgatcaagcgcaagcaccctgag
gcggtccttatcttcgtcctaccgccctccatggaagagttggagaggcgcctgcgagat
cgaaagacggattcagacgaaacgatccgccgccgcatgctggccgcccgctcggagatt
gagcgagggattgcctcctatgactacatcgtcctcaacgacgactttgagcgggccttc
caggaactccggtcggtggtcatcgcggagcgctgcaggcgagggagggtggatctctcg
aagctgaagctggagaaaccccctgcctcggacgcgggccgttga

DBGET integrated database retrieval system