KEGG   Stigmatella aurantiaca: STAUR_6081Help
Entry
STAUR_6081        CDS       T01425                                 

Gene name
fadJ
Definition
(GenBank) Fatty oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00071  Fatty acid degradation
sur00280  Valine, leucine and isoleucine degradation
sur00281  Geraniol degradation
sur00310  Lysine degradation
sur00362  Benzoate degradation
sur00380  Tryptophan metabolism
sur00410  beta-Alanine metabolism
sur00640  Propanoate metabolism
sur00650  Butanoate metabolism
sur00903  Limonene and pinene degradation
sur00930  Caprolactam degradation
sur01040  Biosynthesis of unsaturated fatty acids
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01130  Biosynthesis of antibiotics
sur01200  Carbon metabolism
sur01212  Fatty acid metabolism
Module
sur_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    STAUR_6081 (fadJ)
   00650 Butanoate metabolism
    STAUR_6081 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    STAUR_6081 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    STAUR_6081 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STAUR_6081 (fadJ)
   00310 Lysine degradation
    STAUR_6081 (fadJ)
   00380 Tryptophan metabolism
    STAUR_6081 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STAUR_6081 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STAUR_6081 (fadJ)
   00281 Geraniol degradation
    STAUR_6081 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STAUR_6081 (fadJ)
   00930 Caprolactam degradation
    STAUR_6081 (fadJ)
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     STAUR_6081 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STAUR_6081 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     STAUR_6081 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 LEM
Motif
Other DBs
NCBI-ProteinID: ADO73840
UniProt: Q08VP2
Position
complement(7477356..7479590)
Genome map
AA seq 744 aa AA seqDB search
MAIKLEELEVKHGFSYQVEDGIAVFTFDLPDSAVNTLSPETGLAFDALLDRAEQASEVRA
VVFTSGKKDNFVAGAKIDFLQKIKTAEEAATVARNAQKGFDRLDGFPKPVVAAIHGSCLG
GGLEWALACDYRIITDSPKTVLGLPEVQLGLLPGGGGTQRLPALIGVQAALDLILTGKHV
KPSKAKRLGLVDEVVPVSLLRPLAVRRARELADGTLKVERAHGQGLKAVATQSKKGLAGF
FKSLANKEMWAEVALEDNPLGRKLLFDQARKQLLKKTRGHYPAQEKALEAVRTGVTAGRQ
AGLEAEARLFGELVVSDVSQRLVELFFATTALKKENGTSNPSVKAREIKKVGVLGGGLMG
GGIAYVSSALQGVPVRVKDKDDLGAGRALKQIQGILDERVKKRSLTSRESAAKMALVSAG
TDYSGFKTVDLVIEAVFEDLKLKQRVLAETEAVTHDGCIFASNTSSLPITELAKGSRRPE
LVIGMHYFSPVHKMPLLEIITHPGTAEWVTATCVEVGRKQGKTVIVVNDGVGFYTSRALA
PYMNEAAYLLAEGADIAELDKALVEFGFPVGPITLLDEVGIDVAHKVGPIMEAAFGKRLA
APKTLDKVIEDGRLGRKNQKGFYTYNGKKKEVDASVYALLPAGQDRKDFDLAEMAERCVL
QMVNEAVRCLGEGILRSPRDGDVGAIFGLGFPPFRGGPFRYADRLTPAVLLKRLEHYQDK
FGERFTPAPFLVETVKEGKTFHAR
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggccatcaaactggaagagctcgaggtgaagcacggcttctcctaccaggtcgaggat
ggcatcgcggtcttcaccttcgacctgccggactcggcggtgaacaccctctcgccggag
accggcctcgcgttcgatgcgctgctcgatcgcgcggagcaggcctcggaggtgagggcg
gtggttttcacctcaggaaagaaggacaatttcgtggctggggcgaagatcgacttcctc
cagaagatcaagacggccgaagaggccgccaccgttgcccggaatgcccagaagggtttc
gatcggttggatggctttcccaagcccgtggtggcggccatccatggctcgtgccttggc
ggcggcctggagtgggcgctggcgtgtgattaccgcatcatcaccgacagcccgaagacg
gtgctgggcttgcccgaggtgcagctcggcctgctgcctggtgggggcgggacccagcgg
ctccccgcgctcattggtgtccaggccgcgctggacctcatcctcaccggcaagcacgtg
aagccatcgaaggcgaagcggttgggtctggtggatgaagtggtgccggtgtccttgctg
cgccccttggcggtacggcgcgcgcgcgaactggccgatgggacgctgaaggtggagcgc
gctcacggccagggcctcaaagcggtggccacgcagtccaagaagggattggcggggttt
ttcaagagcctggccaacaaggagatgtgggctgaggtcgccctcgaggacaaccctctc
ggccggaagcttctcttcgatcaggcgcgcaagcagctcttgaagaagacgcgtggccac
tatcctgcccaggagaaggcactggaagccgtgcgcacgggcgtgactgccggccgtcag
gcaggcttggaggccgaggcgcgtctctttggcgaactggtggtgtcggacgtctcccag
cggctggtggagctcttcttcgccaccacggcgctcaagaaggagaacggcacctctaac
ccgagcgtgaaagcccgggagatcaagaaggtgggcgtgctggggggcgggctcatgggc
ggcggcatcgcctacgtgtcttcggcgctccagggggtaccggtgcgcgtgaaggacaag
gatgacctgggcgccgggcgcgccctcaagcagatccaaggcatcctggacgagcgcgtg
aagaagcggtccctgacctcgcgggaatcggccgcgaagatggccctggtctccgcggga
accgactacagcggcttcaagaccgtggacctcgtcatcgaggccgtgttcgaggatttg
aaactcaagcagcgcgtgctggccgagacggaggcggtgacccacgacgggtgcatcttt
gcctccaacacctccagcctgcccatcacggagctggccaaggggagtcggcggcccgag
ttggtcatcgggatgcattacttcagcccggtgcacaagatgcctctgctggagatcatt
acccacccggggaccgccgagtgggtgacggccacctgtgtggaggtgggccggaagcag
ggcaagacggtcatcgtcgtcaacgatggggtgggcttctacacatcgcgcgccctcgcc
ccgtacatgaacgaggcggcgtatctgctggccgagggcgcggacattgccgagttggac
aaggcgctcgtggagttcggcttcccggtcgggcccatcaccttgttggacgaggtcggc
atcgacgtcgcgcacaaggtgggtcccatcatggaggccgccttcggcaagcggctggcg
gccccgaagacgctcgacaaggtcatcgaggacgggcgcctcgggcgcaagaaccagaag
ggcttctacacctacaacgggaagaagaaggaggtggatgcctccgtctacgcgctgctc
ccggcgggacaggaccgcaaggacttcgatctcgccgaaatggcggagcggtgcgtcctg
cagatggtcaacgaggcggtgcgctgcctgggcgagggcatcctccgcagcccgagggat
ggagatgtgggcgccatcttcggattgggcttcccgccgttccgcggaggccccttccgg
tatgcggaccgcttgacacccgccgtgctgctcaagcgcttggagcactaccaggacaaa
ttcggtgagcgcttcacccccgcgcccttcctggtggagacggtgaaggaggggaagacc
ttccacgcgcgttag

DBGET integrated database retrieval system