KEGG   Stigmatella aurantiaca: STAUR_7055Help
Entry
STAUR_7055        CDS       T01425                                 

Definition
(GenBank) AMP-binding protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00010  Glycolysis / Gluconeogenesis
sur00620  Pyruvate metabolism
sur00640  Propanoate metabolism
sur00680  Methane metabolism
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01130  Biosynthesis of antibiotics
sur01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_7055
   00620 Pyruvate metabolism
    STAUR_7055
   00640 Propanoate metabolism
    STAUR_7055
  Energy metabolism
   00680 Methane metabolism
    STAUR_7055
Enzymes [BR:sur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     STAUR_7055
Lipid biosynthesis proteins [BR:sur01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   STAUR_7055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADO74811
UniProt: E3FXL6
Position
complement(8630898..8632571)
Genome map
AA seq 557 aa AA seqDB search
MGACHAFPSIEGAIMSSASPRNMTDYEAVYRSFRWERPEHFNFATDVIDVQASGRPEALA
LLWSDEGGQARRFTFAELRRHSLQAARFLTDLGLRRGDRVFVLMPRIPEWWFIVLGCMRA
GIVFMPGTPMLTAKDIRYRLAAAEARAVITEASCLERFEGLVGTGQVKHWIALGEVPSPW
IRYAPEEGTATDGVSFEPTRADEPMLLYFTSGTTGMPKMVLHTHASYGLGHTVTGRYWLD
LTPEDRHLTLSDTGWAKCAWGKLFGPWSQGACNVVYDYRGRFDAPRILKMLETQRVTTFC
APPTAWRALVLQDLSKYDLSAIRHAVSAGEPLNPEVIDSWKAATGLHIREGYGQTETVVV
VGMFPALEPRVGSMGKPSPGFTVSVIDEQGQEVGPGQEGDIAVRVAPERPVGLFQGYLQD
DAANEACRRGDWYVTGDRAVKDADGYFYFVGRADDVIKTSGYRVGPFEVESALIEHAAVA
ESAVIGVPDERIGQRIKAYVVLAPGYTGSPALATELQEHVKRTTAAYKYPREIEFVTELP
KTVSGKIRRAELRGSAR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgcgtgtcatgctttcccatccatcgaaggagcgatcatgtcctctgcatccccc
cgcaacatgacggactacgaggcggtgtaccggtccttccggtgggagcggcccgagcac
ttcaacttcgccacggacgtcatcgacgtgcaggcatccgggcgccccgaggccctggca
ctgctctggtcggacgagggcggccaggcgcggcgcttcaccttcgcggagctgcggcgg
cactcgcttcaggcggcccgcttcctgacggacctggggttgcggcggggcgaccgggtg
ttcgtcctgatgccgcgcattccagagtggtggttcatcgtgctcgggtgcatgcgcgcg
ggcatcgtcttcatgcccggcacgcccatgctcacggcgaaggacattcgctaccggctg
gcggccgcggaggcgcgggcggtcatcaccgaggcgagctgcctggagcgcttcgagggg
ctggtgggcacggggcaggtgaagcactggattgccctgggcgaggtcccctcgccgtgg
atccgctacgcgccggaggaggggacggccacggatggcgtgtccttcgagcccacgcgg
gcggatgagcccatgctcctctatttcacctcgggcaccacgggcatgccgaagatggtg
ctccacacccatgccagctatggcttggggcacacggtgacggggcgctactggttggat
ttgacgcccgaggaccggcacctgacgctgtcggacacgggctgggccaagtgcgcgtgg
ggcaagttgttcgggccttggagccagggggcgtgcaatgtcgtgtacgactaccgcggg
cggttcgatgcgccgcgcattctgaagatgctggagacgcagcgggtgacgacgttttgc
gcgccgcccacggcgtggcgggcgctcgtgttgcaggacctgtcgaagtacgacctgagc
gccatccgccacgcggtgagcgcgggcgagccgttgaaccccgaagtcatcgacagctgg
aaggcggcaacggggctgcacatccgcgaggggtacgggcagacggagacggtggtggtg
gtggggatgttcccggcgctggagccgcgcgtgggctccatgggcaagccctccccgggc
ttcacggtgtccgtcattgacgagcaaggccaggaggtgggcccggggcaggagggggac
atcgcggtgcgcgtggcgccggagcggccggtggggctgttccagggctatctccaggat
gacgcggccaacgaggcctgccggcgcggggactggtacgtgacgggggaccgggcggtg
aaggacgcggacggctacttctatttcgtggggcgcgcggacgacgtcatcaagacctcg
ggctaccgggtggggccattcgaggtggagtccgcgctcatcgagcacgcggcggtggcc
gagtcggcggtcatcggggtgccggacgagcgcatcggccagcgcatcaaggcctacgtg
gtgctggcgccggggtacacgggctccccggcgctggccacggagctccaggagcacgtg
aagcggacgacggccgcgtacaagtacccccgggagatcgaattcgtgacggagctgccg
aagacggtgagtgggaagatccgccgggccgagctgcggggctccgcgcgatag

DBGET integrated database retrieval system