KEGG   Stigmatella aurantiaca: STAUR_7197Help
Entry
STAUR_7197        CDS       T01425                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00630  Glyoxylate and dicarboxylate metabolism
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01200  Carbon metabolism
Module
sur_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    STAUR_7197 (aceA)
Enzymes [BR:sur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     STAUR_7197 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADO74953
UniProt: Q095X9
Position
8817319..8818605
Genome map
AA seq 428 aa AA seqDB search
MYDATPMTPDSSPHAKLHAQRFEGIIRNYTPKDVEKLRGSLHIRYTLAEVGARRLWELLH
TEEFINALGALTGNQAVQMVRAGLKAIYLSGWQVAADANSAGQMYPDQSLYPVDSVPTVV
RRINAALRRADQIECAEGRTDRYWFAPIIADAEAGFGGPLNAFELMKAMIEAGAAGVHFE
DQLASEKKCGHMGGKVLVPTHQFIRTLTAARLAADVMGVSTLLVARTDADSAKLLMSDAD
PYDHAFIDQTGGRTAEGFYRLKGGVECAISRGLAYAPYADLVWCETSTPDLKQAKQFAEG
IHAKFPGKLLAYNCSPSFNWKKHLDDATIAKFQRELGAMGYKFQFVTLAGFHALNHSMYE
LARQYKDGGMAAYSALQQREFSAEKEGYTATRHQREVGTGYFDQVAEVISGGCSSTLALT
ESTEAHQF
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgcgacgccgatgacccccgattcgtcccctcacgcgaagctccatgcccag
cgcttcgagggcatcatccgcaactacaccccgaaggacgtggagaagctgcgcggctcg
ctgcacattcgctacacgctcgccgaggtgggcgcgcggcgcctgtgggagcttttgcac
accgaggagttcatcaacgccctgggcgcgctcaccggcaaccaggccgtgcagatggtg
cgcgcgggcctgaaggccatctacctgtccggctggcaggtggcggcggacgccaacagc
gccgggcagatgtatccggaccagagcctgtatccggtggacagcgtgcccacggtggtg
cggcgcatcaacgccgcgctgcggcgcgcggatcagatcgaatgtgccgagggccgcacg
gaccggtactggttcgcgcccatcatcgccgacgcggaggccggcttcggcgggccgctc
aacgccttcgagctgatgaaggcgatgattgaagcgggcgcggcgggcgtgcacttcgag
gaccagctggccagcgagaagaagtgtggccacatggggggcaaggtgctggtgcccacc
catcagttcatccgcacgctgacggcggcgcgcctggccgcggacgtcatgggggtgtcc
acgctgctggtggcccgcacggatgccgacagcgccaagctgctgatgagcgacgcggat
ccgtacgaccatgccttcatcgatcagacgggcgggcgcaccgccgagggcttctaccgg
ctcaagggcggcgtggagtgcgccatctcgcgcgggctcgcctatgccccgtacgcggac
ctcgtctggtgtgagacgagcaccccggacctgaagcaggcgaagcagttcgccgagggc
atccacgcgaagttccccggcaagctgctggcgtacaactgctctccttccttcaactgg
aagaagcacctggacgacgccaccatcgcgaagttccagcgggagctgggcgccatgggc
tacaagttccagttcgtcacgctggcgggcttccacgcgctcaaccactccatgtacgag
ctggcccggcagtacaaggacggcggcatggcggcgtactcggccctgcagcagcgcgag
ttcagcgcggagaaggagggctacaccgccacgaggcaccagcgagaggtgggcaccggc
tacttcgaccaggtggccgaggtcatctccgggggctgctccagcacgctggccctcacc
gagtccaccgaggcgcaccagttctag

DBGET integrated database retrieval system