KEGG   Stigmatella aurantiaca: STAUR_7203Help
Entry
STAUR_7203        CDS       T01425                                 

Definition
(GenBank) Aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00350  Tyrosine metabolism
sur00360  Phenylalanine metabolism
sur00380  Tryptophan metabolism
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    STAUR_7203
   00360 Phenylalanine metabolism
    STAUR_7203
   00380 Tryptophan metabolism
    STAUR_7203
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sur04147]
    STAUR_7203
Enzymes [BR:sur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     STAUR_7203
    4.1.1.105  L-tryptophan decarboxylase
     STAUR_7203
Exosome [BR:sur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STAUR_7203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ADO74959
UniProt: Q095X3
Position
complement(8821952..8823466)
Genome map
AA seq 504 aa AA seqDB search
MSEKQEGAVPHLAAEEFRQLGYRMVDWIAGYWDRLESFPVRAPVAPGDVAARLPPHPPEQ
GLDGEKGWEAVFQDLEQVVLPGTTHWQSPSFFGYFPANVSGPAVLGELLSAGLGVQGMLW
STGPACTELEARVMDWLVELLGLPASFLSTSPTGGGVIQGSASEATLVAMVAARARIRRM
SPGDAPLVAYASTQVHSSLLKAAMLCGVARDASDTTHVRTIATDATYGLNPEALERAITE
DLAAGKRPFFVCATLGTTSSGAVDRLGPIGEVLARTGVTASGGWLHVDAAWAGAALVCPE
FREGLAGMEAVDSFCFDPHKWLLTNFDCDAFFTRDRGALLEALSVMPEYLRNTASASGSV
TDYRDWQVPLGRRFRALKLWLVLRHYGRQGLQAYIREHVRLAQRFVGWVAQDARFELAVP
RSLALVCFRLAARPAEASAATDARNRALLERLNATGEVFLSHTVLPGVGERPTRYVLRMA
IGGTRTQEGHVRACWELLQRLASE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagcaagagggggcggtgccgcacctggccgccgaggagttccggcagctg
ggctaccggatggtggattggatcgccgggtactgggaccggctggagtccttccctgtt
cgagcgcccgtggcgccgggcgatgtggcggcccggttgccgccgcatccccccgagcag
gggctggacggggagaagggctgggaggccgtgttccaggacctggagcaggtggtgttg
cccgggaccacgcattggcagtccccctccttttttgggtacttccccgcgaacgtctcg
gggccggcggtgctgggggagctgctctccgcggggctgggcgttcaggggatgctctgg
tccacggggcccgcctgcacggagctggaagcgcgggtgatggactggctggtggagctg
ttggggctgcccgcatcctttctctccacctcccccacgggcggcggcgtcatccaaggc
tccgcgagcgaggcgacgctggtggcgatggtggcggcccgggcgcggatccggcggatg
agtcccggcgatgcgcccctggtggcctatgcctcgacccaggtgcattcctccctcctc
aaggccgccatgctgtgcggcgtggcgagggacgcgagcgacaccacgcacgtgcggacg
attgccacggacgccacctatggcctgaacccggaggccctggagcgggccatcaccgag
gacttggccgcggggaagcggccgttcttcgtctgcgccaccctgggcaccacctcgtcg
ggggcggtggaccggctgggccccatcggcgaggtgctggcccgcacgggcgtcaccgcc
tcgggcggatggttgcacgtggacgcggcgtgggcgggcgcggcgctggtctgcccggag
ttccgggaggggctcgcgggcatggaggcggtggactcgttctgcttcgacccgcacaag
tggctgctcaccaacttcgactgcgatgccttcttcacgcgggaccggggcgcgctgctg
gaggcgctcagcgtgatgcccgagtacctgcgcaacaccgccagtgccagcggctccgtg
accgattaccgcgactggcaggtacccctgggacgccgcttccgagccctgaagctgtgg
ttggtgctgcgccactatgggagacaggggcttcaagcctacattcgcgaacatgtgcgc
ctggctcaacgcttcgtgggctgggtggcgcaggatgcgcgtttcgagctggccgtgccc
cgttccctggccctggtgtgctttcggctcgcggcgcgcccggcagaggcctctgcggcc
acggacgcgcgcaatcgtgccctgctggaacggctgaacgccaccggtgaggtgttcctc
tcgcacacggtgttgccaggtgtgggagaacggcccacccggtacgtgctgcgcatggcc
atcggggggacacgcacacaggaggggcatgtccgggcctgctgggagctgctccagcgg
ctcgccagcgagtga

DBGET integrated database retrieval system