KEGG   Sporosarcina ureae: SporoP32a_00445Help
Entry
SporoP32a_00445   CDS       T04877                                 

Definition
(GenBank) farnesyl-diphosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
sure  Sporosarcina ureae
Pathway
sure00900  Terpenoid backbone biosynthesis
sure01100  Metabolic pathways
sure01110  Biosynthesis of secondary metabolites
sure01130  Biosynthesis of antibiotics
Module
sure_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:sure00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SporoP32a_00445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sure01006]
    SporoP32a_00445
Enzymes [BR:sure01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SporoP32a_00445
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SporoP32a_00445
    2.5.1.29  geranylgeranyl diphosphate synthase
     SporoP32a_00445
Prenyltransferases [BR:sure01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SporoP32a_00445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ARK20150
Position
80796..81680
Genome map
AA seq 294 aa AA seqDB search
MNEKLQAFVDKMIPEIERELTNQLAKPDIPAALHESMTYSIAAGGKRIRPLLVMAVLHDL
NKDSADALKVAASVELIHTYSLIHDDLPCMDDDDFRRGKPTNHKVYGEDVATLSGDAMQA
MAFQALADLRETPPSAAIELVGLLAKASGAQGMVKGQVLDMKGEHQLLPLAELEEVHIHK
TGALLSYCIEAGAVLAQASAEQREQLNRFSRNIGLAFQIQDDILDVTATTEQLGKPANSD
TSSEKSTYPSLLGLDGAREQLKARHEEALDALQSIGLEESVLCLLADYIIERNM
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagaaactacaagcttttgtcgataaaatgattccggaaattgaacgagaatta
acgaatcaattagcgaagcctgatattccggctgctttgcacgagtccatgacgtattcc
atcgctgcgggcgggaagcgtattcgtcctttactcgttatggctgtgttacatgatctg
aataaagattcggcagatgcattgaaagtggcagcttctgtcgaattgatacatacatat
tcattgatccatgatgatctaccttgcatggatgacgatgatttcagaagaggaaaacct
acgaaccataaagtgtatggagaagatgtggcgacactttctggagacgccatgcaagca
atggcattccaggcgctcgcggaccttcgtgaaacaccaccttctgctgcgattgaactc
gttgggttactcgcgaaagcttcaggtgcacaagggatggtcaaaggacaggtccttgac
atgaaaggtgaacatcaattattacctttagctgaattagaggaagttcatattcataaa
acaggcgcattactctcatactgtattgaagcaggcgctgtactagcacaagcttcagca
gaacaacgcgagcaacttaaccgtttttctcgcaacattggattagctttccaaatacaa
gacgatattttggatgttaccgctacgaccgagcaattaggtaagccggcaaatagtgat
acatcaagcgaaaagtcgacgtatccttcattacttggactagacggagcgcgtgaacaa
ttaaaagcgcgtcatgaagaagccctagatgcgttacagtctattggattagaagagtca
gttttgtgtttgttagcggattacatcattgagcgaaatatgtaa

DBGET integrated database retrieval system