KEGG   Sporosarcina ureae: SporoP32a_02475Help
Entry
SporoP32a_02475   CDS       T04877                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
sure  Sporosarcina ureae
Pathway
sure00471  D-Glutamine and D-glutamate metabolism
sure01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sure00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SporoP32a_02475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sure01011]
    SporoP32a_02475
Enzymes [BR:sure01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SporoP32a_02475
Peptidoglycan biosynthesis and degradation proteins [BR:sure01011]
 Precursor biosynthesis
  Racemase
   SporoP32a_02475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race CTP_synth_N
Motif
Other DBs
NCBI-ProteinID: ARK20512
Position
complement(483664..484452)
Genome map
AA seq 262 aa AA seqDB search
MNAPIGVIDSGVGGLTVVRELRKYLPNEPIIYIGDDARCPYGPRPAEEVLRFTMDMVNSL
AQMGIKMLVIACNTATAIALEEVRKQFDFPVVGVIQPGARAAVNASQTGEIAVLGTIGTV
KSKAYEEAIHELRPQAIVHSLACPEFVPIVESGEYRTQAARDIVDQTLLPLHSHSFDSVI
LGCTHYPLLQDHIEAHFSHQKNVISSAVETVIDVERILEAANMLSVSAEEPIFYTTGSMD
KFQVIVEDWLSIPQPDVRLLTF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgcacctattggagtaattgattcaggagtcggcgggcttacagtagttagagag
ttacgcaaatatttgccgaatgaacctataatttatatcggcgatgatgcacgttgtccg
tatggtcctcggcctgcggaagaagtgttgcgatttacgatggacatggtaaatagttta
gcgcaaatgggtataaaaatgctcgttattgcgtgtaacactgcgactgctattgcgctt
gaagaagtacgaaaacaatttgactttcctgtggttggagttattcaaccgggggccaga
gccgctgttaacgcatcgcaaacaggtgaaatcgctgtgcttggtacaataggcaccgtg
aagagtaaagcatatgaagaagcaatacatgagctgagaccacaagcaattgttcattcg
cttgcgtgtccggaatttgtaccaatcgtagagagtggagaatatcgtacacaggcggca
agagatattgtagatcagacattattgcctttgcacagccattcgtttgattctgttata
cttggttgtacgcattatccattattacaagatcatattgaagcccatttctctcatcaa
aaaaatgttatttcttcagcagtggagactgtgattgacgtggagcgtattcttgaagcg
gcgaatatgctgtctgtttcagctgaagagcctatattttatacaacaggctcgatggat
aagtttcaagtcattgttgaagattggctttccattcctcaacctgacgtacgcttatta
acgttttaa

DBGET integrated database retrieval system