KEGG   Sporosarcina ureae: SporoP32a_02645Help
Entry
SporoP32a_02645   CDS       T04877                                 

Definition
(GenBank) hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
sure  Sporosarcina ureae
Pathway
sure00564  Glycerophospholipid metabolism
sure01100  Metabolic pathways
sure01110  Biosynthesis of secondary metabolites
Module
sure_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:sure00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SporoP32a_02645
Enzymes [BR:sure01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     SporoP32a_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ARK20542
Position
519653..520432
Genome map
AA seq 259 aa AA seqDB search
MKTRIFKSFVELTGSPISSALLKQITTSRISKPLIKPFASFYHIQLDEAKYSIEQYKSLN
DFFTRSLQPGKRPIDNHPNSLISPVDGVLSDSGIIDSQQQFIVKDKTYSLTSLLGDSKKS
SRYTHGYYYLFYLSPRHYHHFHYPVSGTLVNRYALGSTSYPVNDLGIRMRKDVFSSNHRV
ISELSTDFGQVAIVKVGALNVNSVRIANSKTSCEKGQDFGHFAFGSTVILFIEQSNIFKP
EEMPFTEVQVGDRIGVWQS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacgtatttttaaatcatttgttgaattaaccggatcaccgatcagttctgct
ttgttaaaacaaataactacttcacgaattagtaaaccgttaatcaagccttttgcatct
ttttatcatattcaactagacgaagctaaatactcaatagaacaatataaaagtcttaat
gactttttcactcgctcattacaacctggtaaaagaccgattgacaaccatccaaacagt
ttgatttcaccagtagatggtgtactgagcgattcaggaattatagactcgcaacagcaa
tttatagtaaaagacaaaacatatagtctgacttcgctgcttggtgattcaaaaaaatcc
tctcgctatacacatggctattattatttattttacctttcacccagacattaccaccat
ttccactaccctgtttcaggaacgctagtgaaccgttatgcattaggttctacttcttat
cctgttaacgatttaggtattcgtatgcgtaaagatgtattttcttccaatcacagggtt
atttctgagctttccacagattttggacaggtggccattgttaaggttggtgcattaaat
gtaaatagtgtccgcattgcaaattctaaaactagttgtgaaaaaggacaagattttggt
cattttgcatttggttctactgttattttattcattgaacagagtaatatatttaagccc
gaagaaatgccttttacagaagtccaagttggtgataggatcggagtgtggcaatcttaa

DBGET integrated database retrieval system