KEGG   Sporosarcina ureae: SporoP32a_04370Help
Entry
SporoP32a_04370   CDS       T04877                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
sure  Sporosarcina ureae
Pathway
sure01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sure00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SporoP32a_04370
Enzymes [BR:sure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SporoP32a_04370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Acid_phosphat_B Corona_NS2 PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: ARK23067
Position
complement(864148..864915)
Genome map
AA seq 255 aa AA seqDB search
MKQYKAYCFDLDGTMYRGTEPIQEAVDFVATCQAQGKDTYFITNNAALTRTAQQEKLASF
GVQTEVDYIMNSATALARYCALHYAGANVMMIGEAGLREALEIEHINITTTNPDVVLMGL
DRQITYGKLADACLAIRSGAHFLGTNQDVKFPTEKGLVPGNGSFLKMMEAATETKPLIVG
KPEPHMLEFIQQQGMYKKEDMILIGDNYDTDIMAGIRYGIDTAYVATGVTPMEEVLEKAQ
QPTYLLNSLADWPIN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatataaagcctattgcttcgatttggatggcacgatgtatagagggactgaa
ccgatacaggaagctgtagatttcgttgcaacgtgccaagcgcaaggcaaggacacatac
tttattacgaacaacgcggctcttacacgcactgctcaacaggagaaactagcgagtttt
ggggtacagacagaagtcgattacatcatgaattcagcgactgcactggcgcgttactgt
gccctacattacgcaggcgctaacgtgatgatgattggtgaagcaggattgcgagaagcg
ctagaaatcgagcacatcaacattaccacgacgaatcccgatgtcgtcttaatgggactt
gaccgccagattacatacggcaaactcgcggatgcctgtctggcgatacgtagcggtgca
catttcttaggcaccaatcaagatgtcaaattcccgaccgaaaagggactcgtaccaggt
aacggttcgttcttaaaaatgatggaagcagcaactgaaacaaagccactcatcgtagga
aagcccgagccgcatatgctggagttcatccagcagcaggggatgtacaagaaagaagat
atgatcctcataggcgacaactacgatacagacatcatggcgggcatccgctacggtatc
gacacggcgtacgttgcgacaggggtcacaccaatggaagaagtgctagaaaaagcacag
caacccacgtatctactgaactcacttgcagattggccaattaactaa

DBGET integrated database retrieval system