KEGG   Sporosarcina ureae: SporoP32a_09825Help
Entry
SporoP32a_09825   CDS       T04877                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sure  Sporosarcina ureae
Pathway
sure00450  Selenocompound metabolism
sure00970  Aminoacyl-tRNA biosynthesis
sure01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sure00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SporoP32a_09825
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SporoP32a_09825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sure01007]
    SporoP32a_09825
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sure03016]
    SporoP32a_09825
Enzymes [BR:sure01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SporoP32a_09825
Amino acid related enzymes [BR:sure01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SporoP32a_09825
Transfer RNA biogenesis [BR:sure03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SporoP32a_09825
 Prokaryotic type
   Other AARSs
    SporoP32a_09825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 Prok-RING_1 DNA_ligase_ZBD zf-Mss51 Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ARK23135
Position
1987192..1989186
Genome map
AA seq 664 aa AA seqDB search
MKVHIKYLEELHVENQSKTFYITTPIYYPSGKFHIGTAYTTIASDAMARYKRLRGYDVRF
LTGMDEHGQKIQEKAEEEGLSPIKYVDGIADVAKDLWKLMDITYDDLIRTTEDRHKTVVE
KIFKKFLDNGDIYKGKYEGWKCVPCESYFTESQLVDGNCPDCGRPVHRVEEESYFFNMKK
YADRLLAYYEENPTFIEPESRKNEMINNFIKPGLEDLSVSRMSFDWGIKVPGDPKHVIYV
WVDALTNYITALGYMSDDESLFNKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKV
FAHGFIMMKDGKMSKSKGNVVYPEMLVERYGLDATRYFLLRELPFGQDGVFSPEAFVERI
NYDLANDLGNLLNRTISMINKYFDGEILTKDLVPTEFDAPLRDMIQHTVKKYETSMEKMQ
FSVVLSDVWALISRTNKYIDETSPWVLAKSEEDRMKLASVMYHLALSLHHTAILLQPFMT
NAPKQMIEQLGLTEDSLNWASLDEGYAIPAGTKVIKKGVPIFPRLETEVEVEYIRQQMAI
TAPAEVEEKVEEVKEETNEITFEAFMNVDMRVATVTACEKMPKADKLLKLQVDLGYEQRQ
VVSGIAQHYSAEDVVGMKVIVVANLKPVKLRGELSQGMILAGEKDGVLKLATVDPSLENG
AQVK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacacatcaaatatttggaggaattacacgtggagaatcaatctaaaacattt
tatattacaacacccatttattatccaagtgggaaatttcatataggaacggcatataca
acaatcgcttctgacgctatggcgcgttataagcgtttgcgcggatatgacgtcagattc
ctaactggaatggacgagcatggacagaagatccaagaaaaggcagaagaagaaggtcta
tcgcccattaaatatgttgacggtattgcagacgttgcgaaggacctatggaaactgatg
gatatcacgtacgatgacttaatccgtacaacagaagatcgtcacaagacagtcgttgaa
aagatattcaagaaattccttgataatggagacatttataaaggaaagtatgaaggatgg
aaatgcgtgccatgtgaatcatactttaccgagtcgcaacttgttgacgggaattgtccg
gactgcggccgccccgttcaccgcgtagaagaagagtcgtacttcttcaacatgaagaaa
tacgcagaccgcttacttgcgtattatgaagagaatcctacatttattgaaccagaatca
cgcaaaaatgaaatgatcaataacttcattaaacctggacttgaggatttatccgtttct
cgtatgtcatttgactggggaattaaagtgcctggagatccaaagcacgttatttacgta
tgggtcgatgcattgacaaattatattactgctcttggttatatgtccgatgacgaatct
ttattcaataaatactggccagcggatgttcatgtagtagggaaagatattgttcgtttc
catacaatctattggccgatattcttgatggcacttgatcttcctttgccaaaaaaggta
tttgcacatggattcatcatgatgaaagacggcaaaatgtctaaatctaaaggtaatgta
gtgtatccagaaatgctcgttgaacgctatggcctcgatgctacacgttatttcttgctt
cgtgaattaccgttcggacaagatggtgtattctcaccggaggcatttgtcgagcgtatt
aactatgacttagcgaatgatttaggaaacttattaaaccgaaccatctccatgatcaat
aaatacttcgatggagaaattttaacaaaggatcttgtgccgacggagtttgatgcgccg
ttacgtgatatgattcagcatacggtgaagaaatatgagacttctatggaaaaaatgcag
tttagtgtcgtactttctgacgtgtgggcattgatttcccgcacaaataagtatattgat
gagacatctccatgggtattggcaaaatcagaagaagatcgcatgaaactagcgtccgtt
atgtatcatttagcattatctcttcatcatacagcaatactcttgcagccattcatgaca
aacgcgcctaaacaaatgatagaacaactgggtctcactgaagattcattgaactgggct
tcattagatgaaggctatgctattcctgcaggtacaaaagttatcaaaaaaggtgttccc
atcttcccgcgtcttgaaacagaagtagaagttgaatatattcgtcagcaaatggcgatt
acggcacctgctgaagtagaagagaaggtagaagaagtgaaagaagaaacaaatgaaatt
acgtttgaggcattcatgaatgtagatatgcgtgtagcaactgtcacagcatgcgaaaaa
atgccgaaagctgacaagttgttgaagttgcaagtggacttgggttacgagcaacgtcaa
gtcgtgtctggtattgcgcaacattacagcgctgaagacgtagtaggcatgaaagtaata
gttgttgcgaatttgaagccggttaaactgcgtggagaattatcacaaggtatgatcttg
gcgggcgaaaaagacggtgtgttaaaacttgcaacagtcgatccttcattagagaacggc
gcacaagtaaaataa

DBGET integrated database retrieval system