KEGG   Sporosarcina ureae: SporoP32a_12020Help
Entry
SporoP32a_12020   CDS       T04877                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sure  Sporosarcina ureae
Pathway
sure00071  Fatty acid degradation
sure00072  Synthesis and degradation of ketone bodies
sure00280  Valine, leucine and isoleucine degradation
sure00310  Lysine degradation
sure00362  Benzoate degradation
sure00380  Tryptophan metabolism
sure00620  Pyruvate metabolism
sure00630  Glyoxylate and dicarboxylate metabolism
sure00640  Propanoate metabolism
sure00650  Butanoate metabolism
sure00900  Terpenoid backbone biosynthesis
sure01100  Metabolic pathways
sure01110  Biosynthesis of secondary metabolites
sure01120  Microbial metabolism in diverse environments
sure01130  Biosynthesis of antibiotics
sure01200  Carbon metabolism
sure01212  Fatty acid metabolism
sure02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sure00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SporoP32a_12020
   00630 Glyoxylate and dicarboxylate metabolism
    SporoP32a_12020
   00640 Propanoate metabolism
    SporoP32a_12020
   00650 Butanoate metabolism
    SporoP32a_12020
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SporoP32a_12020
   00072 Synthesis and degradation of ketone bodies
    SporoP32a_12020
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SporoP32a_12020
   00310 Lysine degradation
    SporoP32a_12020
   00380 Tryptophan metabolism
    SporoP32a_12020
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SporoP32a_12020
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SporoP32a_12020
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SporoP32a_12020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sure04147]
    SporoP32a_12020
Enzymes [BR:sure01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SporoP32a_12020
Exosome [BR:sure04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SporoP32a_12020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C DbpA ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARK22186
Position
2439865..2441055
Genome map
AA seq 396 aa AA seqDB search
MRTVILQGARTPFGKLSGALQSQTASDLGGIAIKEALSRAGVQGDEVDEVIMGTVLQAGQ
GQIPSRQAAVKGGIPYGVKTETINKVCASGMRSITLGDQLIRLGDETTIVAGGMESMTNA
PYYANVRSGLKMGDSTLVDGMIYDGLTCSFSEGNVHMGTYGNSTANDFSVSRETQDKWSL
RSHERALAAIDNGLFAEEIVGVSIPQRKGDPIVVTEDEGPRRGSSLEALAKLRPAFGKEG
SVTAGNAPGINDGACAVVLMNEEEAKKQGKEPLAVILGHAEVAIEPERFPETPGHVIKAL
LEKTGKTADEIDLYEINEAFAVVALASSQIAGLDEEKVNVNGGAVALGHPIGASGARVVL
TLANELKRRGGGIGIAAICSGGGQGDAIMIEVPKTN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagtaatcttacaaggtgctagaacaccatttggaaaactaagcggtgcattg
cagtcccaaacagcaagcgatcttggtggtatcgcaataaaggaagcgctttcacgcgct
ggagtacaaggcgatgaagtagacgaagtcatcatgggaacagtattgcaagcaggccaa
ggtcaaattccttcccgtcaagcagctgtcaaaggcggcattccatacggcgttaaaaca
gaaacaattaacaaagtatgtgcttcaggcatgcgcagtatcacactcggagatcagctc
atccgtcttggcgatgagacgacaatcgtcgcaggcggtatggaatctatgaccaacgca
ccgtattatgcaaatgtccgttcaggtttgaaaatgggcgatagcacattggtagacggc
atgatctatgatggactgacatgttcattctccgaaggcaatgtccacatgggcacatac
ggaaacagcacagcaaacgacttctctgtgagccgtgaaacgcaagataaatggtcactg
cgcagtcatgaacgtgcgcttgcagcaatcgataacggattattcgcagaagaaatcgtt
ggagtcagcattccacaacgtaaaggcgatccgatcgttgtaacggaagacgaaggtcca
cgtagaggtagctcgcttgaagcgctagctaaattgcgtccggctttcggtaaagaaggc
agtgtcacagcaggaaatgcaccaggcatcaatgacggagcgtgcgcggttgtcttaatg
aatgaagaagaagcgaaaaagcaaggcaaagaaccacttgcggttattctcgggcacgca
gaagtcgcgatcgaaccagaacgtttccctgaaacaccaggtcacgtcatcaaggcatta
cttgagaaaacaggtaaaactgcagacgaaatcgatctatacgaaatcaatgaagcattc
gcagtcgttgcgctggctagctcacaaattgctgggctcgatgaagaaaaagttaacgtc
aatggtggagcagtcgcactaggacacccaatcggtgcaagtggagcgcgtgttgtgctt
acactagcaaatgaattaaaacgtcgtggtggcggaatcggtatcgcagcaatctgttca
ggtggcggccaaggcgatgccatcatgattgaagtacctaaaactaactga

DBGET integrated database retrieval system