KEGG   Sporosarcina ureae: SporoP32a_14475Help
Entry
SporoP32a_14475   CDS       T04877                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
sure  Sporosarcina ureae
Pathway
sure00471  D-Glutamine and D-glutamate metabolism
sure00550  Peptidoglycan biosynthesis
sure01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sure00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SporoP32a_14475 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SporoP32a_14475 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sure01011]
    SporoP32a_14475 (murD)
Enzymes [BR:sure01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     SporoP32a_14475 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:sure01011]
 Precursor biosynthesis
  Amino acid ligase
   SporoP32a_14475 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C Oxidored_nitro AlaDh_PNT_C Pyr_redox_3 FMO-like GlnD_UR_UTase AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ARK22635
Position
2986082..2987431
Genome map
AA seq 449 aa AA seqDB search
MKNTEQFIGKRVLVVGLAKSGVATAGLLQRLGAEVVVNDSKPVEGNEEAMELQARGIEVI
GGGHPSDLLERNFDFIVKNPGIPYTNSLLAKAVEQNIPIWTEVELASILSEAPIIAITGS
NGKTTTTTLLYHMLNLGKKHPLIAGNIGTVSCTVAEKAKANEVIVLEASSFQLAGTESFT
PRIAIFTNLYEAHLDYHGSMNEYLDAKLQVARNQTSEEYLIFNADQQLIKEAIESFESHK
VPFSVLGKTREGISADEEWIYWLGEPFIEIKHIKLPGRHNLENVLSATAAAILSGCEKTA
IENVLSSFTGVRHRMQFVREANSRTIYNDSKATNTLATKSALSSFKKPIVLIAGGLDRGH
SFEELRPYMKNVRAVVTIGETAKRFADFAMSCGITETVQATTMQDAVQKAYKCSCEDDVI
LLSPSCASWDQYKSFEIRGNEFIDAVMKL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatacagaacaattcatagggaaacgggtacttgtagtcggacttgcgaagagc
ggagtggcaacggcaggtttgcttcagcgtcttggtgcggaagttgtagtcaatgattca
aagcctgtagaaggtaatgaagaagcaatggaacttcaagcgcgaggaattgaagttatt
ggaggggggcacccgagtgatttactagagcgaaatttcgacttcatcgtaaaaaatccg
ggtatcccttacactaattcgctactagcgaaggcagttgagcagaatattccgatttgg
actgaagttgaattggctagtattctcagcgaggcaccaattattgcgattactggatcg
aacggtaaaacgacaaccactacattgttgtatcacatgctaaatttgggtaagaaacat
ccactaatagcgggtaatattggaacggtctcttgtacggtcgctgaaaaggcgaaagcg
aatgaagtaattgtacttgaagcttcgtcgtttcagttagctgggacagaaagctttact
ccacgcattgcaatttttacgaatttgtatgaagcgcatttggattatcatggatcgatg
aatgaatatctcgatgcgaagttgcaagtagcccgcaaccaaacttcggaagaatactta
atttttaatgcggatcaacagttaataaaagaagcaatagaatcattcgaatctcacaaa
gtacccttttcagtacttggaaaaactagagaaggtatttcagcagatgaagaatggatt
tattggcttggtgaacctttcatagaaattaagcatattaaattaccgggtcgtcacaat
ttagaaaatgttttatccgcaacggcggcagccatattgtcagggtgtgaaaaaacagcg
atagaaaatgttttgagttctttcaccggtgttcgccatcgcatgcaatttgtacgtgaa
gcaaatagccgtacaatatacaatgactcaaaagcgacgaatacattggcaacaaaaagt
gcactttcctcatttaaaaagccaatcgttttgattgctgggggactagacagaggccat
tcatttgaagaattacgaccttatatgaaaaatgttcgtgctgtcgtcacgataggggag
acggcaaagcgttttgcagactttgctatgtcttgtggcatcactgagacagttcaggca
acaactatgcaggacgcagtccagaaggcatataagtgtagctgtgaagatgatgtgatt
ctattgtcgccgagctgtgcaagttgggatcaatacaagagctttgaaattcggggcaac
gaatttattgatgcagtaatgaagttgtaa

DBGET integrated database retrieval system