KEGG   Sporosarcina ureae: SporoP32a_16200Help
Entry
SporoP32a_16200   CDS       T04877                                 

Definition
(GenBank) hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sure  Sporosarcina ureae
Pathway
sure03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sure00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SporoP32a_16200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sure03400]
    SporoP32a_16200
Enzymes [BR:sure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SporoP32a_16200
DNA repair and recombination proteins [BR:sure03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SporoP32a_16200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 AAA_11 Viral_helicase1 AAA_18 AAA_28 AAA_12 AAA_22 UvrD_C AAA_16 AAA_17 AAA_33 TsaE Helicase_RecD RsgA_GTPase AAA_14 T2SSE JHBP DUF2075 AAA UvrD-helicase Zeta_toxin Rad17 NTPase_1
Motif
Other DBs
NCBI-ProteinID: ARK22958
Position
3329410..3331836
Genome map
AA seq 808 aa AA seqDB search
MSETAPYLIGRPVVTIFHNTTNLFSIVKLKVTSTNTDYRDSEIVIKGSFPPLVAEEDYKF
TGRLVNHPVHGQQFDVQTFSKELPATEAGLILYLSGDLFPGIGKKTASDIVKTLGNNVIQ
KVLEDRSVLDQIPRLSDERKDTLVSVLQENLGLERTMVQLNEWGFGPQVAMRIYQAYQDD
AITILTENPYRLIKEIEGIGFQRADDLAKQLGLVGDHPARIKAAVYYSVHSEVQSAGHVY
VESGVILPQAKQLLESSQAHIISYESITQAVIELVEEGTLSAEMQRLYLPSLYFSEIGIA
AKVNKILENEVAEQFPASEIRKAIGEIEERLEVQYAETQVEAIERALHSSLLVLTGGPGT
GKTTVIRGLVEAYAELHGISLDLDEYARKKEPFPIILAAPTGRAAKRMSESTGLPAMTIH
RLLGFTGQDAEEETEREVDGNLIIIDETSMVDTWLMHQLLKAVRNDAQLLFVGDQDQLPS
VGPGQVLHDFMQSGKIPVVELTDIFRQSEGSTIIEMAHMIKQKEWTMDVTKKTSDRSFIK
ASSDQILPAVKQIIQNATSKGHSIKDIQVLAPMYKGPAGIDGLNKMIQEVTNPPAEGRKE
MVFGETTYRVGDKVLQLVNQPESNVFNGDMGEVVAIMLAKETTDKKAIMVVSYDGNEVQY
ERSDLNQLTLAYCCSIHKSQGSEFPIVVMPIVRSQRKMLRRNLLYTGITRAKNFLILCGE
AEEFKAGIARTDETERQTTLQERITGETQEVQTTQTVETISLDTAPAKVTAEPQDMSQAK
LTMDNFTAIDPLIGMNNVSPLDFLEVTD
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaacagcaccatatctaatcggtaggccggtcgtgacgattttccataatacg
acgaatctattttccatcgtcaagttaaaagtcacttccaccaatactgattaccgcgac
agtgaaatagtgatcaaaggctctttccctcctctcgtcgcggaagaagattacaaattc
acaggacgactcgttaaccatccagtacatggacagcagttcgacgtgcagacattctca
aaagagttgcctgcgacagaggcgggtctgatcctgtacttatctggtgatttatttcct
ggaatcgggaagaaaacagctagtgatatcgtgaagacactcggcaataacgtcatccag
aaagtccttgaagaccgcagtgtactggatcagattccgcgtttgagtgacgaacggaaa
gatacgctcgtttcagtcttgcaggagaatctaggtcttgaacgtactatggtgcaactc
aatgaatggggcttcggtccacaagtggctatgcgtatataccaagcgtatcaagatgat
gccatcacgattctgacagaaaatccatatcgtttaattaaagaaattgaagggatcggc
tttcaacgtgcagatgatctcgcgaagcaactcgggctcgtaggagatcatcctgcgcgt
attaaagcagctgtttattacagcgtacatagtgaagtacagtcagcaggacatgtctac
gtagagtcaggggtgatcttgcctcaagcgaagcagctacttgaatcgagtcaggcacat
attatctcgtacgaatcgatcacccaagccgtgattgaactcgtcgaagaaggcacactg
tctgctgaaatgcagcgactctatttaccctctctttatttttcggaaattgggattgcc
gctaaagtcaataaaattctcgaaaatgaagtcgcggaacaatttcccgcttctgaaata
cgaaaagcaattggtgaaatagaggaacgtttggaagtgcagtatgccgaaacgcaagta
gaagcgatcgaacgcgcccttcattcttcattactcgtgctaacaggtggacccgggaca
ggtaagacaaccgtcataagaggtttagttgaggcgtacgcagaactgcatggtatctca
cttgacctcgacgaatatgcacgtaaaaaagaaccgtttccgatcatcttggcagcccct
accggacgcgcagcgaaacggatgtccgaatcaaccggattacctgccatgacgatccac
cgcctactcggatttacgggtcaggacgccgaagaagagacggagcgggaagtggatggc
aatctcatcatcattgacgaaacgtccatggtcgatacgtggctcatgcatcagctgtta
aaagctgtccgcaatgatgcacagttattattcgttggagatcaggatcaactaccttct
gtaggacctggtcaagtgttgcatgacttcatgcagtcaggaaaaattccggtcgttgaa
ctgaccgatattttccggcaaagtgaaggctcaaccatcatcgaaatggcccatatgatc
aagcaaaaagaatggacgatggatgttacaaagaagacgtcggatcggtcgtttattaaa
gcgtcgagtgatcaaattttgcctgcagttaaacaaatcattcaaaacgccacatccaaa
gggcattccattaaagatattcaagtgctagcgccgatgtacaaaggtccagcaggcata
gatggtttgaataagatgatacaagaagtcacgaatccacctgccgaaggaagaaaagaa
atggttttcggagaaacgacgtatcgtgtcggggataaagttctgcaactcgtcaatcag
ccggaaagtaatgttttcaatggggatatgggagaagtcgttgcgatcatgctagcgaaa
gaaacgactgacaaaaaagcgatcatggtcgtttcgtacgacggcaatgaagtgcaatac
gagcgaagcgacttgaatcagctgacacttgcgtattgttgttctattcataaatcccaa
ggtagcgaatttccaatcgttgtcatgccgatcgtcagaagtcagcggaaaatgttacgg
cgtaatctgctgtacacagggattacgcgtgcaaagaacttcttaatactttgcggtgaa
gcagaagaatttaaagcaggcattgcgcgcaccgacgaaaccgagcgacagacgacactt
caagaacgcataactggggaaacacaagaagttcagactacacaaaccgtggaaacaatc
tcactcgatacagcacctgcaaaagtgacggctgaaccacaagatatgtcacaagcgaag
ttaacgatggacaattttactgcaattgatccgctcataggtatgaacaatgtgtcacca
ctcgactttcttgaagtgactgattga

DBGET integrated database retrieval system