KEGG   Candidatus Solibacter usitatus: Acid_7743
Entry
Acid_7743         CDS       T00412                                 
Name
(GenBank) transcriptional regulator, LacI family
  KO
K02529  LacI family transcriptional regulator
Organism
sus  Candidatus Solibacter usitatus
Brite
KEGG Orthology (KO) [BR:sus00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sus03000]
    Acid_7743
Transcription factors [BR:sus03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    Acid_7743
SSDB
Motif
Pfam: Peripla_BP_1 Peripla_BP_3 Peripla_BP_4 LacI HTH_3 Peripla_BP_6
Other DBs
NCBI-ProteinID: ABJ88641
UniProt: Q01NX9
Position
9721922..9722932
AA seq 336 aa
MPSIKKVAEVAGVSVGTVSHVITGSVNVSEPLRMKVQAAIRELNYHPNHVARSLKTSKTR
TLGIIVPDLTISFFPQIIRGAETAARQRRYSIIAVNSDDDGERQKELLSLLHSQRVEGIL
LVIAAAPTPQSQIGRILDADIPVVCLDRVPDRIAVDSVSVDDLEAARMGVAHLVERGFRR
IAIMTGPMSLRNERRRLQGYRQALDEAGIKIDERLIWNGTLHLEEVTALCRERLCDKASR
PDALFCTNGHNALGVLRAFRDCGLETPRDIGFLTFDELTVEDLFTPSITTIVQPAYDIGY
RAGMILLDRIEGLATQESSITVRLPATLKIRASTRR
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgccgagcatcaagaaggtggccgaggtagccggtgtttcggtggggacggtctcccac
gtgatcaccggctcggtcaacgtgagtgagccgctgcggatgaaagttcaggctgcgatc
cgagagctgaactaccatccgaatcacgtggcgcgcagcctgaagaccagcaagacgcgc
acgcttggaatcatcgttccggacctgacgatctccttcttcccacagattattcgcggc
gcggaaaccgccgccaggcagcgccgctattcgattatcgcggtgaactcagacgatgat
ggcgagcgccagaaggagctgctctcgttgttgcactcgcagcgggtggaaggaatcctg
ctggtgattgccgccgcgcctacgccgcagagccagatcgggcggattctcgacgccgat
attccggtggtctgcctggatcgcgtccccgaccggattgcggtggactcggtctcggtg
gacgacttggaggccgcgcgaatgggtgtcgcgcacctggtggagcgcgggttccgccgc
attgcgatcatgactggcccgatgtcgttaagaaatgagcggcggcgccttcagggctac
cggcaggcgctggacgaagccggcatcaagatcgacgagcgcctgatctggaacggcacg
ctgcatctggaggaagtgaccgcgctctgccgcgaacgcctgtgcgataaggcgtcgcgc
cccgacgcgttgttttgcaccaacggacacaatgcgctcggcgtgctgcgcgcctttcgc
gattgcggactggagacaccgcgcgatatcggctttctcaccttcgacgagctcacggta
gaagatcttttcacgccttcgattacgacgatcgtgcagccggcttacgacatcggatac
cgggcgggcatgatcctgctggatcggatcgaaggtctggccacacaggagagttcgatc
acggtgcgactgccggcgacgctgaaaattcgggcgtcgacgaggcggtaa

DBGET integrated database retrieval system