KEGG   Candidatus Solibacter usitatus: Acid_0231
Entry
Acid_0231         CDS       T00412                                 

Definition
(GenBank) Uncharacterised conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
sus  Candidatus Solibacter usitatus
Brite
KEGG Orthology (KO) [BR:sus00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sus02044]
    Acid_0231
Secretion system [BR:sus02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Acid_0231
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABJ81244
UniProt: Q02CH2
Position
312973..313491
AA seq 172 aa
MAKQSTQHKLDRVRSPRVQITYDVEMGGAIELKELPFVMGVMGDFTGQPTEPLARVKDRK
FVDVNPDNFDAVLESMKPHLAFSVENKLSEDPEAPKLKVDLNFKSMDDFSPDSVARQVKP
LRELLELRDRLSDLRGSMQGNDKLEELLREAVTDKDKLARLKSELGKEGSNE
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcgaaacagagcacacagcataaactggaccgcgtccgctctccacgcgtgcaaatc
acctacgacgtcgaaatgggcggggccatcgagctcaaggaattgccttttgttatgggc
gtaatgggagacttcacgggccagccgaccgagccgttggcgcgcgtgaaggaccgaaag
ttcgttgacgtcaacccggataacttcgatgctgtcctggagagcatgaaaccgcacctc
gccttctcggtggagaacaaactgagcgaggatcccgaagcacccaagcttaaagtcgat
ctcaacttcaagagcatggacgatttttcgccggacagtgtcgcccggcaagtcaagcct
ctgagagagttgctggaattgcgagaccggctatccgatctgcgcggcagcatgcagggc
aacgacaaactggaggagttgctccgcgaggcggtcaccgataaggacaaactggcgcgc
ctcaagagtgagctgggcaaggaggggtccaatgagtaa

DBGET integrated database retrieval system