KEGG   Candidatus Solibacter usitatus: Acid_0237Help
Entry
Acid_0237         CDS       T00412                                 

Definition
(GenBank) protein of unknown function DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
sus  Candidatus Solibacter usitatus
Brite
KEGG Orthology (KO) [BR:sus00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sus02044]
    Acid_0237
Secretion system [BR:sus02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Acid_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: ABJ81250
UniProt: Q02CG6
Position
318584..320425
Genome map
AA seq 613 aa AA seqDB search
MRDDLLLYYERELTFLRQMGAEFAAKYPKVASRLVIEPDKCEDPHVERLLEAFAFLTARV
HLKIDDEFPEITEGLLNILHPHYLRPIPSMSVAEFQVEPSQAPPEGGLKLPRGAVLNSRP
VNGVPCKFRTCYDLTFWPVEVTDAEWKTPDRLQPPVKSVDTVAAVRVVLKCPGELTFAKL
GLSSLRFYLNGESNLVHTLYELLCNQCAHIIIRDLSPKSKTQPVILTGDALRPVGFGEDE
GMLPYARRSFVGYRLLQEYFCFPQKFFFLDLTGLDRICEAGFGGQVEVLFMISPFERGER
RQMLELGVSAKTFRLGCAPIVNLFAQTAEPILLSHMRYEYPIVPDVSRRRASEVFEITEV
QSANPQSGEVVRFEPFYSYRHGSNRATTQAFWRASRRASGRRDDDSTEVFLSLVDLSSRP
VRPNVEALVVRTICSNRDLPSRLPFGNEAGDFELEGAIPVKRIVALIKPTDALRPPVGKD
SMWRLVSQLSLNYLSLVENGREALQEILRLYNFAESTHFEKQIQGLVALDSRRHFARVIS
DDGVVFARGTQVDMEFDEEQFVGGGVYLFASVLEHFLGLYVSMNSFSRLRVRTRQRKEVL
RQWPPRAGQKILL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggatgacctgctgctctactacgagcgcgaactgaccttcctgcgccagatgggg
gcggagtttgccgccaagtatcccaaggtggcttcgcggctggtgatagagccggataag
tgcgaagacccgcacgtggaacgcctgctggaagcatttgcattcctcacggctcgggtc
cacctcaagatcgacgacgaatttccggagatcaccgagggcctgctcaatattctccac
ccgcactacctgcggccgattccctccatgtcggtcgcggagtttcaggtggaaccgtcc
caggcgccgccagagggcggtttgaaactgccgcgaggggcggtattgaactcgcggccg
gtgaacggagtgccctgcaaatttcgtacctgctacgacctgacgttttggcccgtcgag
gttaccgacgccgagtggaagacgccggaccgcctgcagcctccggtcaagtccgtcgac
acggtggccgcggtacgcgtggttttgaaatgtcccggggaattgacgtttgccaagctg
gggctttcttccctgcgcttctatctgaatggcgaaagcaatctggtccacacgctgtat
gagctgttgtgcaaccagtgcgcgcatatcatcatccgcgacctgtctccaaaatcgaag
acgcaaccggtgattctgaccggggacgcgctgcggcccgtggggtttggcgaagacgaa
gggatgctgccctacgcgcgccggtccttcgtgggctaccggctgctgcaggaatacttc
tgcttcccgcagaagttcttcttcctggacctgacggggctggaccggatttgcgaagcc
ggcttcggcggtcaggtggaagtcctgttcatgatttcgccgttcgagcgcggcgagcgc
cgccagatgctggaactcggggtgagcgccaagacgtttcgcctgggctgcgcgccaatc
gtcaacctgttcgcgcaaacggcggagcccattctgctgagccacatgcgctacgaatac
ccgatcgtgcccgacgtcagccgccgccgggccagtgaggtctttgagatcaccgaggtg
cagagcgccaatcctcaatcgggcgaggtggtccggttcgagccgttctattcctatcgc
cacggatcaaatcgcgctacgacccaggcgttctggcgtgcctcaaggcgcgcctcggga
cgccgcgacgacgactccacggaagtctttctctccctggtggatctttcgtcacggccg
gtgcggccgaacgtggaagcgctcgtggtgcgcaccatctgcagcaaccgggatctaccc
tcgcggctgccgttcggtaatgaggcgggagatttcgaactcgagggcgcgattccggtg
aagcgcatcgtcgcgttgatcaagcccaccgatgcgctgcgcccgccggtgggcaaggac
tccatgtggcgcctggtgtcgcaactgtcgcttaactatctgtccttggtcgaaaacggc
cgcgaggcgttgcaggaaatcctgcggctctacaacttcgcggagtccactcacttcgag
aagcagattcaaggcctggtggcgttagacagccggcggcacttcgcgcgcgtgatctcc
gatgacggcgtcgtgttcgcgcgcggaacccaggttgacatggagttcgacgaggaacag
ttcgtgggcggcggcgtctatctcttcgcctcggtgctggagcattttctgggcctgtac
gtttcgatgaacagtttcagccggctccgcgtgcgcacccggcagcggaaggaggttctg
cgacagtggccaccacgagcgggtcagaaaatactgctctag

DBGET integrated database retrieval system