KEGG   Candidatus Solibacter usitatus: Acid_0446Help
Entry
Acid_0446         CDS       T00412                                 

Definition
(GenBank) L-glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00220  Arginine biosynthesis
sus00250  Alanine, aspartate and glutamate metabolism
sus00471  D-Glutamine and D-glutamate metabolism
sus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acid_0446
   00220 Arginine biosynthesis
    Acid_0446
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Acid_0446
Enzymes [BR:sus01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Acid_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Big_1
Motif
Other DBs
NCBI-ProteinID: ABJ81456
UniProt: Q02BW0
Position
551155..552240
Genome map
AA seq 361 aa AA seqDB search
MAQNTSYKLLAAATLLATGLVLTNLPGEQAAAGRAARLSTNRSPVAPADAQIQAAINEAY
ARYRSDTSGKNADYIPYLAQVDSKLFGIAAVTTDGRVFTAGDVDFSFSMQSISKVFTLAL
AMEELGADKVFERIGAEPTGRPFNSVTAVEDMPGHTANPFVNAGAIATTSLVSGSDPNAK
WDKILAFYNKVAGEKLKLIDDVYKSEAATNMHNKAIATLLASYERMYSDPLEATDIYTRQ
CSVGVTAKELAVMGATLADQGRNPITGIQVIKPENVPHILAVMSMAGLYDGSGGWAWKVG
LPAKSGVGGGILAIVPGKGAIVGFAPRLDKAGNSVKAQKSIAYVADKLDINLYSPGSVGL
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaatacgtcctacaaactgctagctgctgcaaccttgctggcaacggggctg
gtgctgaccaatcttcccggtgagcaagccgcggccggccgggctgcccggcttagcacg
aaccgcagcccggtagctcccgcggacgcccagatccaggccgccatcaatgaggcctac
gcgcgctatcgcagcgacacaagcggcaagaacgccgattacattccctatctcgcccag
gtggactcgaagttgttcggcatcgccgccgtcactaccgacggccgcgtcttcaccgcc
ggcgacgtggatttttcgttctccatgcagtccatttccaaagtctttacgcttgccctc
gccatggaggaattgggcgcggacaaggtcttcgaacggatcggcgccgagcccaccggc
cggcccttcaactccgtcaccgcagtcgaggacatgccgggtcacacagccaatcccttc
gtcaacgcaggcgccatcgccaccaccagtctcgtgtcaggctccgacccgaatgccaag
tgggataagattctcgccttctacaacaaggtagcgggcgaaaagctcaagctgatcgac
gacgtctacaaatcggaggccgcgaccaacatgcacaacaaggccatcgcgaccctgctc
gccagttacgagcgcatgtattccgacccgctcgaagctactgacatttacaccaggcag
tgctccgtcggcgtaaccgcgaaagagcttgccgtaatgggtgccacgctcgccgatcag
ggccgaaatccgatcaccggcatacaggtaattaagcccgagaatgtcccgcacatcctg
gccgtcatgtcgatggccggcctgtacgatggctcgggcggctgggcctggaaggtcggt
cttcccgccaagagcggtgtcggcggcggcatcctcgccattgtccccgggaagggcgcg
atcgtcggctttgctccgcgcctggacaaagccggcaatagtgtgaaagcgcagaagtcg
atcgcctatgttgcagacaagctcgacatcaatttgtattccccgggttcggtcggcctc
aagtga

DBGET integrated database retrieval system