KEGG   Candidatus Solibacter usitatus: Acid_0546Help
Entry
Acid_0546         CDS       T00412                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00260  Glycine, serine and threonine metabolism
sus00750  Vitamin B6 metabolism
sus01100  Metabolic pathways
sus01110  Biosynthesis of secondary metabolites
sus01120  Microbial metabolism in diverse environments
sus01230  Biosynthesis of amino acids
Module
sus_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acid_0546
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Acid_0546
Enzymes [BR:sus01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Acid_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABJ81552
UniProt: Q02BL4
Position
657907..659130
Genome map
AA seq 407 aa AA seqDB search
MPKATHLECSLCATKFDAGAAANLCACGGPLLVRYDLATIRHRWLRREVSNGPATMWRYA
PVLPPSDASVVTLGEGWTPLVRTKRLGARIGADSLWVKDEGLNPTASFKARGLSCAVSMC
VELGIKKVAIPSAGNAASAMAAYAAAAGIEAHIFMPRDVPQANYLECKAYGAHVTLIDGL
ISDCGRMVAEQGPKEGWFDVSTLKEPYRIEGKKTMGYEVAEQMGWELPEAIFYPTGGGVG
MIGMWKAFDEMERLGWIGGRRPKMIAVQAEGCQPVVRAFEAGEQRSKFFEGAHTVASGLR
VPKPLGDFLVLNAVRESGGTAIAVCDEDMLTAGVHLASDEGIYAAPEGAACVCAAQRLLK
SGFLKSTDRMVIYNTGSGLKYPEAYSTRFPRTAASEQDKLGGLITPR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagcgacccatctggagtgcagcctttgcgcgacgaagttcgacgccggggca
gccgccaacctctgcgcgtgcggaggccctttgctggtccggtacgatctggccactatc
cgacaccgctggctgcggcgcgaggtctccaatggcccggctacgatgtggcgttatgcg
ccggtgctgccgccatccgatgcttcggtggtgacactcggcgaaggctggacgccgctg
gtgcgcaccaagcgcctgggtgcgcggatcggagctgattcgctctgggtcaaagacgaa
gggctcaaccccacggcgtcgttcaaagctcgcgggctctcctgcgcggtatcgatgtgc
gtggaactcggaatcaagaaggtcgcaattccctccgcggggaacgcggcgagcgcgatg
gcggcgtacgcggcggccgccggcattgaggctcacattttcatgccgcgcgacgttccg
caagccaattacctggagtgcaaggcgtacggcgcgcacgtcacgctgattgacgggcta
atcagcgattgcggccgcatggttgccgaacaaggccccaaggaaggctggttcgacgtt
tcgacattgaaggagccataccgcatcgagggcaagaagacgatggggtacgaggtggcg
gagcagatgggttgggaactgccggaagcgattttctatccgaccggcggcggcgtgggc
atgatcggcatgtggaaggcgttcgacgaaatggaaaggctgggctggatcggcggacgg
cgtcccaaaatgatcgcggtgcaggcggaaggctgccagccggtggtgcgtgcattcgaa
gcgggcgagcagcgcagcaaattcttcgaaggcgctcatacggtggcgagcggactccgc
gtccccaaaccgctcggcgattttctggtgctgaacgcggtccgggagagcggtggtacg
gccatcgcggtgtgcgacgaagatatgttgaccgccggagtgcacctggccagcgacgag
ggcatctacgcggcaccggagggcgcagcctgtgtgtgcgccgcgcaacgcctgctgaaa
tccggattcctcaagagcactgatcgcatggtgatctacaatacgggatcgggtttgaag
taccccgaagcgtattcgacgcgattcccgcggacggcggcgagcgagcaggacaaacta
ggcgggctgatcacgccgcggtag

DBGET integrated database retrieval system