KEGG   Candidatus Solibacter usitatus: Acid_0761Help
Entry
Acid_0761         CDS       T00412                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00860  Porphyrin and chlorophyll metabolism
sus01100  Metabolic pathways
sus01110  Biosynthesis of secondary metabolites
sus01120  Microbial metabolism in diverse environments
Module
sus_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Acid_0761
Enzymes [BR:sus01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Acid_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABJ81760
UniProt: Q02B06
Position
959829..960581
Genome map
AA seq 250 aa AA seqDB search
MEQLIRKQGGEPFVAPSMREIPLTDNEEAFAFAERLFAGEFDMAIFLTGVGTRLMDRVLA
TRYDQGALAAALRRIAVVARGPKPAAALREMGVAPAVIAPEPNTWRELLAAIEGRMERRI
AVQEYGRPSQELLDGLRARGAEVTRVRIYQWELPEDTQPLREAVRRLSAGAIDIVLFTTA
IQMAHLARIAREEGLEAALLENLRKCRVCSIGPTTTEALEEFGVHPAMEPSHPKMGFLVK
EAAEGANGHE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggagcagttgattcgcaagcaggggggtgaacctttcgtggcaccttccatgcgcgaa
atcccgctgacggataacgaggaggctttcgccttcgccgaacggcttttcgccggcgag
ttcgatatggcaattttcctgaccggcgtgggcacgcgcctgatggatcgcgtactggcg
acccggtacgaccagggcgcgctggcggcggcgctgcggcgcatcgcggtggtggcccgc
ggtcccaagcctgccgccgcccttcgtgaaatgggagtcgcccccgccgtaatcgcgccc
gagccgaacacttggcgggaactgctggccgcgatcgaaggccgcatggagcggcgcatc
gccgtccaggaatatgggcgccccagccaggaattgctcgatgggctgcgtgcgcgcggc
gccgaagttacccgcgtgcgcatctaccaatgggaattgcccgaggacactcagccgctt
cgtgaagcggtacggcgtttgagcgcaggagccattgatatcgtgctgtttacgacagcc
atccagatggctcacctggcgcgcatcgcgcgtgaagaaggcctggaggcggcgctcctc
gaaaacttgcgcaagtgccgggtatgttcgattggacccaccactaccgaggcgctcgaa
gagttcggagtgcatcctgcgatggagccatcccatccgaaaatggggttcctggttaag
gaagccgcggaaggcgcgaatgggcatgaataa

DBGET integrated database retrieval system