KEGG   Candidatus Solibacter usitatus: Acid_1182Help
Entry
Acid_1182         CDS       T00412                                 

Definition
(GenBank) Aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00350  Tyrosine metabolism
sus00360  Phenylalanine metabolism
sus00380  Tryptophan metabolism
sus01100  Metabolic pathways
sus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Acid_1182
   00360 Phenylalanine metabolism
    Acid_1182
   00380 Tryptophan metabolism
    Acid_1182
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sus04147]
    Acid_1182
Enzymes [BR:sus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Acid_1182
    4.1.1.105  L-tryptophan decarboxylase
     Acid_1182
Exosome [BR:sus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acid_1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABJ82176
UniProt: Q029V0
Position
complement(1455413..1456825)
Genome map
AA seq 470 aa AA seqDB search
MNPEEFRRRGHQIIDRIADYRANVARYPVMARTAPGEIKAALPAEPPENPESFDEVLADL
DRVVMPGLSHWQHPRFFGYFPSNGELSSVLGDYLSTGLGVLGLSWQSSPALSEVEEVVTD
WMRQMTGLSAEWSGVIQDTASTCTLVALLCARERSTGYGLARGGLQAEAQPLIVYTSGHS
HSSVDKAALLAGFGRENVRHIASDEKFALRPEALEEAIREDLAAGRKPCAIAGTTGTTAT
TALDPIADMARIAREYGLWLHVDAAMAGSAMVLPECRWMWDGIEGADSVVLNPHKWLGAA
FDCSLYYVRGPEHLIRVMSTSPSYLRTAADDQVKNLRDWGLPLGRRFRALKLWFLIREQG
VKGLQARLRRDLVNAQWLTSAICAEPNWRVLAPVPLQTLCVRHEPPGLEGEALDRHTQAW
ADRINRSGEAYLTPAILEGRWMVRVSVGALLTEREHVEALWRLMRKEAGG
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctgaagaatttcggcgccgggggcatcagatcatcgatcggattgcggattat
cgagccaatgtggcgcggtatccggtgatggcgcggacggctcccggcgaaatcaaggcg
gcgctgcccgccgaaccgccggagaatccggaaagcttcgacgaggtgctggccgatctc
gaccgggtggtgatgcccggactctcgcactggcagcacccgcggttcttcggctacttc
ccttccaacggcgagctctcgagcgtgctgggcgattacctctccaccggattgggggtg
ctgggactctcctggcaatccagcccggcgctgagcgaagtcgaagaggtggtgaccgac
tggatgcggcagatgaccggactttcggcggaatggagcggcgtgattcaggacaccgcc
tccacctgtacgctggtggcgctgctgtgcgcgcgcgagcgctccaccggctacggcctg
gcgcgcggcggattgcaggcggaagcgcagccgctaatcgtttacacctccgggcacagt
cacagttcggtggataaagcggcgctgctcgcgggcttcggccgagagaacgtgcgacat
atcgcgagtgatgagaagttcgcgctgcgaccggaggcgctggaggaggcgatccgcgaa
gacctggcggcggggcgaaaaccttgcgcgatcgccggcaccactgggactacggcgacg
accgcgctcgaccccattgcggacatggcgcgcatcgcacgagagtatggactctggctg
cacgtggacgcggccatggcgggttctgccatggtgctgcctgagtgccgctggatgtgg
gacggcatcgaaggcgcggattccgtggtgctcaatccgcacaagtggctcggggcggcc
ttcgattgttcgctatattacgttcggggccccgagcacctgattcgcgtcatgtccacg
agtcccagctacctaaggaccgcggccgacgatcaggtcaagaacctgcgcgattgggga
ctgccgctgggtcgccggttccgcgccctgaagctctggtttctgattcgcgagcaagga
gttaagggattgcaggcccggctgcgccgggatctcgtcaacgcgcagtggcttacctcc
gcaatctgcgcggagccaaactggcgagtcctggccccggtaccgctgcagacgctgtgc
gtccggcacgagccgccggggttggagggtgaagcgctggaccgccacacgcaggcatgg
gcggaccgcatcaatcgctcgggagaggcgtacctgacgccggcgattctcgagggccgg
tggatggtgcgggtgtcggtcggcgcgctcctgaccgaacgggagcacgtagaggctttg
tggcggctgatgcgaaaagaagcgggcggctga

DBGET integrated database retrieval system