KEGG   Candidatus Solibacter usitatus: Acid_1738
Entry
Acid_1738         CDS       T00412                                 

Definition
(GenBank) Animal haem peroxidase
Organism
sus  Candidatus Solibacter usitatus
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-ProteinID: ABJ82728
UniProt: Q027S9
Position
complement(2158439..2160238)
AA seq 599 aa
MPESILGKLTEYLGQNWPWYKQPLPLALASLIEIRDELRAKNLHDTEEPPFAQNAGALPA
GVKEARTADGTYNDLKYPAMGSRGCRFGRNFPLDAVHPDTANLMSPNPREVSSRLLARRE
FQPAGFLNLLTATWIQFMVHDWFVHRQSTEKHEIPIGPDDAWPDKPMTVTKSAISPAPAG
STHPPAFINDNTHWWDASQLYGSDAATAVKVRSGVDGKLKIGADGKMLVDPATGEDLTGF
EDNGWVGLSMLHGLFVAEHNSICDMLKAHNPDWNDDRLHAKARLINVALIAKIHTAEWTP
AILPNPITQKAMHTNWYGLAGDELQDVFKFLNESEVMGGIPGSETNHHSAPYSLTEEFVS
VYRMHALIPDEFVIRSTENDATVARYQLPEIFGKRGRAEMAKLSLADLFYSFGTTHPGAV
RLHNFPNALRDLHKDDGTHLDLASIDILRDRERGVPRYNQFRRLLRKDPVQSFEELTGGD
EALAQELREVYGNDLEKVDLMVGLYAEPLPEGFGFSETAFRIFVLMASRRLKSDRFFTND
YTDAMYTAEGMEWIRANGMFSVIARHMPQVAAAFEGVENPFAPWKTAGGVVAKATAASS
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgccggaatcgatacttggaaaattgaccgaatacctgggccaaaactggccctggtac
aaacagcccctgccgctcgcgctggccagcctgatcgaaattcgcgacgaattgcgcgcg
aagaacctccatgacaccgaggagcctccgtttgcgcagaacgcgggcgcgctgcccgcg
ggcgtgaaggaagcgcgcaccgccgacggcacctataacgatctgaagtatccggcgatg
ggcagccgcggctgccgcttcggacgcaattttccgctcgatgccgtgcatcccgatacc
gccaatctcatgtcaccgaatcctcgcgaagtgagttcgcggctgctggcgcggcgcgag
tttcaacccgcgggctttctcaacctgctcaccgccacctggattcagttcatggtccac
gattggttcgtgcaccgccaatcgacggagaagcacgagattccgatcggccccgacgat
gcctggcccgacaaaccgatgacggtcaccaagagcgcgatctcgccggcgccggccggc
tcgacgcatccacctgccttcatcaacgacaacacgcactggtgggacgcctcgcagttg
tacggctccgacgccgctacagcggtcaaggtgcgcagcggagtagatggcaaactcaag
atcggggccgatggaaagatgctggtggacccggctaccggggaggacctgaccggcttc
gaggataacggctgggtcggcctgagcatgctccacggcctcttcgtcgccgagcacaac
tccatctgcgacatgctcaaggcgcacaatcccgattggaacgacgatcgccttcacgcc
aaggcgcggctgatcaacgttgcgctgatcgccaagattcatacggcggagtggaccccc
gcgattctgcccaacccgatcacacagaaggccatgcacaccaactggtacggcctggcc
ggcgacgagttgcaggatgtcttcaagttcctgaacgaaagcgaagtgatgggcggcatt
cctggctcggagacgaatcatcacagcgccccgtattcgctcacggaagagttcgtctcg
gtgtaccgcatgcacgcgctgatccccgatgagttcgtgatccgttcgaccgagaacgac
gcaaccgtggcgcgttatcagttgcccgagatcttcggcaagcgcggccgggctgagatg
gcgaagctatcgctcgccgatctgttttattccttcggcacgacacacccgggcgcggtg
cggctgcacaattttccgaatgccctgcgcgatctgcacaaggatgacggcacgcatctt
gacctggcatcgatcgacattctgcgcgaccgcgagcgcggcgtaccgcggtacaaccag
ttccgccgcctgctgcgcaaggatccggtacagtctttcgaggaactgaccggcggcgac
gaggcgctggctcaggaacttcgcgaggtgtacggcaacgatttggagaaggtagacctg
atggtgggactctacgccgaaccgctgcccgaaggcttcggcttcagcgagacggccttc
cgcattttcgtgctgatggcatcgcggcgtttgaagagcgaccggttcttcaccaatgac
tacacggacgcgatgtatacggccgagggcatggagtggatccgcgccaatgggatgttc
tccgtgatcgcgcggcacatgccgcaagtggccgcggccttcgagggcgtggaaaacccg
ttcgcaccttggaagaccgcgggtggggtggtggcaaaggcgacagcggcttcgagctag

DBGET integrated database retrieval system