KEGG   Candidatus Solibacter usitatus: Acid_2820Help
Entry
Acid_2820         CDS       T00412                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00052  Galactose metabolism
sus00561  Glycerolipid metabolism
sus00600  Sphingolipid metabolism
sus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Acid_2820
  Lipid metabolism
   00561 Glycerolipid metabolism
    Acid_2820
   00600 Sphingolipid metabolism
    Acid_2820
Enzymes [BR:sus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Acid_2820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Glyco_hydro_97 Melibiase
Motif
Other DBs
NCBI-ProteinID: ABJ83806
UniProt: Q023N4
Position
complement(3574061..3575548)
Genome map
AA seq 495 aa AA seqDB search
MKLSFVFFCAASCFAADLSGNWASGNAGVDGIARKVYFNLKQDGSRITGHIRSTQFYYTI
KESTGDASGFTLTASMMDGKSERTVRYEGKLEGEELHLGTRRNATAPLSQLVARRVPEGE
GAYPARIPPPALHKVPANGLAKTPPMGWNSWNKFAGRVDDKSVRDMADAIVTSGMRDAGY
VYVNIDDTWEGERDAKGNITSNKKFPDMKALADYVHGKGLKLGIYSSPGPNTCAGYEGSY
GHEEQDAKTWAAWGIDYLKYDWCGARNLYTDDEMQAVYQKMGDALRASGRPILYSLCQYG
RADVWKWGPEVGGNAWRTTGDIKDTWDSMTNIGFKQNELAQWAAPGHWNDPDMLEIGNGG
MNDDEYRTHMSLWSMLAAPLLAGNDLRTASPAILAILTNRDVIAIDQDKDGKQGRRAWKS
GDQEIWVRDLAGGDRAVAIFNRGAEKADVKMKWSELEVNAPAQAKNLWSHQEEKLQGSEF
ALSVPAHGVVLLRVR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatccttcgtctttttctgtgcggcctcctgtttcgcggccgacctaagcggc
aattgggcctctggcaatgccggagtcgatggcattgcccgcaaggtctacttcaacttg
aagcaggatggctcgcgcatcacgggccacatccgctccacgcagttttactacaccatc
aaggaaagcaccggcgacgcatcgggcttcacgctcacggccagcatgatggatggcaag
agtgaacgcacggtccgctacgaaggcaagctcgaaggcgaagaactccacctgggcact
cgccgcaatgccaccgcgccgctcagccagctggtggcgcgccgcgtgcccgagggcgaa
ggcgcgtatcctgcccgcattcctccgcccgccctgcataaggtgcccgccaacggcctg
gccaagacgccgccgatgggttggaacagctggaacaaattcgccggccgcgtagacgat
aagagcgtccgcgacatggccgacgcgatcgtgaccagcggcatgcgcgacgcgggctac
gtctacgtgaatatcgacgatacctgggagggcgagcgggacgccaagggtaatatcaca
tcgaacaagaagttccccgacatgaaagcgctggccgattacgtccacggcaagggcctc
aagctcggcatttactcttcgcccgggcccaacacctgcgccggttacgagggcagctac
ggacacgaagagcaggacgcgaagacctgggcggcctgggggatcgattacctgaaatac
gattggtgcggcgcgcgcaacctttacaccgacgacgaaatgcaggccgtgtaccagaag
atgggcgatgccctgcgcgcctccggccgtccgatcctgtacagcctctgccagtacggc
cgcgcggacgtttggaagtggggacccgaagtgggaggtaacgcgtggcggaccaccggc
gatatcaaggacacgtgggattccatgactaatatcgggttcaagcaaaacgaactcgcc
caatgggccgcgcccggccactggaacgacccggacatgctcgagatcggcaatggcggc
atgaacgacgacgaatatcgcacgcacatgagcctctggtcgatgctcgcggcgcccctg
ctggcgggcaacgatctgcgcacggcttcgcccgcaatcctcgcgattctgaccaatcgc
gacgtgatcgcgatcgaccaggacaaggatggcaagcagggccgtcgcgcgtggaaatcc
ggcgatcaggagatctgggtccgcgacctcgccggtggcgatagggcggtagcgatcttc
aatcgcggcgcggagaaggccgacgtgaagatgaagtggagcgagctggaagtgaacgcg
ccggcgcaggcgaaaaacctctggtcgcaccaggaggagaaactccagggcagcgagttt
gccctgtcagtgcccgctcacggtgtcgtgctgctgcgcgtgcggtaa

DBGET integrated database retrieval system