KEGG   Candidatus Solibacter usitatus: Acid_3378Help
Entry
Acid_3378         CDS       T00412                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00020  Citrate cycle (TCA cycle)
sus00640  Propanoate metabolism
sus00660  C5-Branched dibasic acid metabolism
sus01100  Metabolic pathways
sus01110  Biosynthesis of secondary metabolites
sus01120  Microbial metabolism in diverse environments
sus01130  Biosynthesis of antibiotics
sus01200  Carbon metabolism
Module
sus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sus_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acid_3378
   00640 Propanoate metabolism
    Acid_3378
   00660 C5-Branched dibasic acid metabolism
    Acid_3378
Enzymes [BR:sus01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Acid_3378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABJ84351
UniProt: Q021N6
Position
complement(4278829..4279983)
Genome map
AA seq 384 aa AA seqDB search
MKIHEYQAKAILAQYKVPVPRGHVAYTEADAETAAKTLGGSVVVKAQIHAGGRGKGGGVK
VAKDAAEALELAKKILGMTLVTHQTGPEGRLVQRLLIEETLPIERELYLGIVLDRVQGKP
VFMASSAGGMDIEEVAAKTPELILKETLEYPGLSPYQARKLAFGIGIPAASVNAAAAAMT
ALSKAYWAMDASLAEINPFILTTDGKVYALDAKITFDDNALYRHKELVELRDLNEEDPLE
VEASKHGLNYIKLDGTVGCMVNGAGLAMATMDIIKFAGGSPANFLDVGGGANAEQVKNAF
RILLSDHSVKAVLINIFGGILRCDTLATGVVAAARDLNIQVPIVVRMEGTNVEAGRQILL
ESGFNFTVGADMWDAAQKVVKLAA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcacgagtatcaagccaaggccattctggcccaatacaaagtccctgtgcca
cgagggcatgtcgcatacacggaagcggacgcggaaaccgcggccaaaacgctgggcggc
tcggtggtggtgaaggcacagattcacgcgggcggccgcggcaaaggcggaggagtgaag
gtcgccaaagatgccgccgaagcgcttgaactggcgaagaagattctggggatgaccctg
gtcactcaccagaccggaccggaagggcggctggtgcagcgcctgctgatcgaagaaacg
ctgccgatcgaacgcgagttgtatctcggcatcgtgctggaccgggtgcagggcaagccg
gtcttcatggcgtcctcggcgggcggcatggacatcgaagaagtcgcggccaaaacgccg
gaactgatcctcaaggagacgctggagtatccgggcctctcgccctaccaggcgcgcaag
ctggcgtttggcatcggtatcccggcggcgagcgtgaatgcggcggcggcagcgatgacg
gcgctctccaaggcatactgggcgatggacgcgtcgctggcggagatcaaccccttcatc
ctgacgaccgacggcaaggtttacgcgctcgacgcgaagatcaccttcgacgacaacgcg
ctgtatcgccacaaagaactggtggagctgcgcgatttgaacgaggaagatccgctggag
gtggaagcctccaagcacggcttgaattacatcaagctggatggcacggtgggctgcatg
gtgaatggcgccggactcgcgatggcgaccatggacatcattaaattcgcgggcggcagt
ccggcgaacttcctggatgtgggcggcggggccaacgcggagcaagtgaagaacgcgttc
cggattctgctttcggatcacagcgtgaaggcggtgctgatcaacatcttcggcggcatt
ctgcgctgcgacacgctggccaccggcgtggtggcggcggcgcgcgacctgaacatccag
gtgccgatcgtggtgcgcatggaaggcaccaacgtggaagcgggccggcagattctgctg
gaatcgggattcaactttacggtgggcgcggacatgtgggacgccgctcaaaaagtagtg
aagctggctgcgtga

DBGET integrated database retrieval system