KEGG   Candidatus Solibacter usitatus: Acid_4374Help
Entry
Acid_4374         CDS       T00412                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00010  Glycolysis / Gluconeogenesis
sus00260  Glycine, serine and threonine metabolism
sus00680  Methane metabolism
sus01100  Metabolic pathways
sus01110  Biosynthesis of secondary metabolites
sus01120  Microbial metabolism in diverse environments
sus01130  Biosynthesis of antibiotics
sus01200  Carbon metabolism
sus01230  Biosynthesis of amino acids
Module
sus_M00002  Glycolysis, core module involving three-carbon compounds
sus_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid_4374
  Energy metabolism
   00680 Methane metabolism
    Acid_4374
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acid_4374
Enzymes [BR:sus01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Acid_4374
Membrane trafficking [BR:sus04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Acid_4374
Exosome [BR:sus04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Acid_4374
  Exosomal proteins of melanoma cells
   Acid_4374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABJ85335
UniProt: Q01YD0
Position
5536569..5537315
Genome map
AA seq 248 aa AA seqDB search
MKKLVLIRHGESTWNKENRFTGWTDVDLSDEGRQQATEAAEVLKREGYVFDVAYTSVLKR
AIRTLWTVLDGMDLMWIPVHRSWRLNERHYGALQGLNKAETAAKFGEDQVKIWRRSYDIP
PPVLTADDPRFPGHDPRYQSLTKEELPLTECLKDTVARFLPLWHDTIAPAIRSGQRVIIA
AHGNSLRALVKYLDGVSEADIVELNIPTGMPLVYELDDDLKPLNRYYLGDPEKVKAAMEA
VAAQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaactcgttctcatccgccacggcgaaagcacgtggaacaaagaaaatcgcttc
accggctggaccgacgtcgatctctccgacgaaggccgccagcaggccaccgaagccgcc
gaggtgctcaaacgggaaggctacgtctttgacgtggcctacaccagcgtcctcaagcgc
gcgatccgcactctgtggacggtgctcgacggcatggacctgatgtggatcccggtgcac
cgctcctggcgcctgaatgaacgccactatggcgcgctgcagggccttaacaaggcggag
acggccgcgaagttcggcgaggaccaggtcaaaatctggcgccgcagctacgacatccca
ccgcccgtcctgaccgcggacgacccgcgcttccccggccacgacccgcgctaccagagc
ctcaccaaggaagagctcccgctcacggagtgcctgaaggacaccgtggcgcgcttcctt
cccttgtggcacgacaccatcgcgcccgcgatcaggagcggtcagcgcgtcatcatcgcc
gcccacggcaacagcctgcgcgctctcgtgaagtacctcgatggcgtcagcgaagccgat
atcgtcgagctcaatatccccaccggcatgccgctagtttatgagctcgatgacgacctc
aaacccctaaaccgctactacctcggcgacccagagaaggtgaaggccgccatggaagcc
gtcgccgcccagggcaagaagaagtag

DBGET integrated database retrieval system