KEGG   Candidatus Solibacter usitatus: Acid_4926Help
Entry
Acid_4926         CDS       T00412                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00625  Chloroalkane and chloroalkene degradation
sus00680  Methane metabolism
sus01100  Metabolic pathways
sus01120  Microbial metabolism in diverse environments
sus01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Acid_4926
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Acid_4926
Enzymes [BR:sus01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Acid_4926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Pyr_redox_2 HI0933_like 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABJ85885
UniProt: Q01WT0
Position
complement(6220552..6221766)
Genome map
AA seq 404 aa AA seqDB search
MKAVVYKGKNKVAVEEVSNPKIEAPGDVIVKITTAAICGSDLHMYEQRSNAEPGTVFGHE
NQGVVEEVGNGVVSIKRGDRVVLPFNIACGFCFNCARGYTNACLTANPEAPTAGYGYAGM
GPYRGGQAEFLRVPFADFNCLKLPGQPGDQFEDDFVLLADIFPTGWHAAELANVKGGDSV
AVFGAGPVGLLSAYSAFIKGASEVYVVDRAPDRLARAKSIGAIAVDFTQGDPVEQIKELR
SKNRAHSQALRPGEEKMAGVNCAIDAVGYQARSQSDPDREDPMQTIRQITDIVNPTGSVG
LIGVYFDEDPGGVDKHAKKGEFLFPLGKLWSKGITIGQGQAPVKKYNVYLRDLIIAGKAK
PSFIVSHRLPLARAEEAYAHFDHRGVGSGKDWTKVLLKPEMKAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtggtttataaaggaaagaacaaagttgccgtagaagaggtctccaatccc
aaaatcgaggctcccggcgacgtgattgtgaaaatcacaacggcggcgatctgcggcagc
gacctgcacatgtatgagcagcgcagtaacgccgaacccggaaccgtttttggacacgag
aaccagggcgtggtggaagaggtgggcaacggagtcgtctccatcaagcggggcgaccgc
gtagtgctgccctttaacatagcctgcggtttctgtttcaactgcgcgcggggttacacc
aacgcctgcctgaccgccaaccccgaggcgccgaccgccggctacggctacgccggtatg
ggaccataccgcggcggccaggccgagttcctgcgagtgccgttcgcggacttcaattgc
ctcaaactccccggccagcccggagaccagttcgaggacgatttcgtactgctcgccgat
attttcccgaccgggtggcatgccgcggaacttgcgaacgtaaaaggcggcgattcggtc
gccgtcttcggcgccggtccggtgggcctgctctccgcatacagcgcgttcatcaagggc
gcatcggaggtgtacgtagtggatcgcgcgccggaccggctggcgcgcgcgaagagcatc
ggagccatagcggtggattttacccagggcgatccggtggagcagatcaaggaactccgc
tccaagaaccgcgcgcattcacaggcgctccggcccggggaagagaagatggcgggggtc
aattgcgccatcgacgcggtgggctaccaggcccgcagccagtctgatccggaccgggaa
gaccccatgcagactatccggcagatcaccgacatcgtcaacccgacaggttcggtaggc
ttgatcggcgtgtacttcgacgaagatccgggcggcgtggacaagcacgccaagaaaggc
gaattcctgttcccgctgggcaagctttggagcaaaggaatcacgatcggccagggacag
gccccggtgaaaaaatacaacgtgtatctacgcgacctgattatcgccggcaaagctaaa
cccagcttcatcgtgagccaccggttgcctctggcaagggcggaggaggcctacgcgcat
ttcgatcatcgtggagtcggcagtggcaaagactggaccaaggtcctgttgaagccggaa
atgaaggcagcctag

DBGET integrated database retrieval system