KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00361Help
Entry
SAT0131_00361     CDS       T01888                                 

Definition
(GenBank) Probable acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
sut00071  Fatty acid degradation
sut00072  Synthesis and degradation of ketone bodies
sut00280  Valine, leucine and isoleucine degradation
sut00310  Lysine degradation
sut00362  Benzoate degradation
sut00380  Tryptophan metabolism
sut00620  Pyruvate metabolism
sut00630  Glyoxylate and dicarboxylate metabolism
sut00640  Propanoate metabolism
sut00650  Butanoate metabolism
sut00900  Terpenoid backbone biosynthesis
sut01100  Metabolic pathways
sut01110  Biosynthesis of secondary metabolites
sut01120  Microbial metabolism in diverse environments
sut01130  Biosynthesis of antibiotics
sut01200  Carbon metabolism
sut01212  Fatty acid metabolism
sut02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAT0131_00361
   00630 Glyoxylate and dicarboxylate metabolism
    SAT0131_00361
   00640 Propanoate metabolism
    SAT0131_00361
   00650 Butanoate metabolism
    SAT0131_00361
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAT0131_00361
   00072 Synthesis and degradation of ketone bodies
    SAT0131_00361
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAT0131_00361
   00310 Lysine degradation
    SAT0131_00361
   00380 Tryptophan metabolism
    SAT0131_00361
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAT0131_00361
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAT0131_00361
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAT0131_00361
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sut04147]
    SAT0131_00361
Enzymes [BR:sut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAT0131_00361
Exosome [BR:sut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAT0131_00361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AEB87460
Position
372308..373489
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacggtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgtagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgattaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacatcctattggtgcatctggtgctagagtattagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system