KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00672Help
Entry
SAT0131_00672     CDS       T01888                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
sut00010  Glycolysis / Gluconeogenesis
sut00071  Fatty acid degradation
sut00350  Tyrosine metabolism
sut00625  Chloroalkane and chloroalkene degradation
sut00626  Naphthalene degradation
sut01100  Metabolic pathways
sut01110  Biosynthesis of secondary metabolites
sut01120  Microbial metabolism in diverse environments
sut01130  Biosynthesis of antibiotics
sut01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAT0131_00672
  Lipid metabolism
   00071 Fatty acid degradation
    SAT0131_00672
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAT0131_00672
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAT0131_00672
   00626 Naphthalene degradation
    SAT0131_00672
Enzymes [BR:sut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAT0131_00672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C BKACE Methyltransf_11 ADH_N_2 Methyltransf_25 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AEB87741
Position
673397..674407
Genome map
AA seq 336 aa AA seqDB search
MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQ
VIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNVKPGQWLGVFGIGGLGNLALQY
AKNVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNKGLDATVVTSVA
KTPFNQAVDVVKAGARVVAVGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQDLREAFEFAA
ENKVTPKVQLRKLEEINDIFEEMENGTITGRMVIKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagttgtaacgaaagatcacaaagtaagtattgaggacaaaaagttaaga
gctttaaaacctggtgaagcgttggtacaaacggaatattgtggcgtttgtcataccgat
ttacatgttaagaatgctgattttggtgatgttacaggcgttactttaggtcatgaaggt
attggtaaagtcatcgaagttgcggaagatgtagaatcattaaaaattggagaccgtgtg
tctatcgcttggatgttcgaaagctgtggaagatgtgaatattgtacaacaggtcgtgaa
acactttgccgtagtgtgaaaaatgctggttatacagtagatggtgcaatggctgaacaa
gttattgttactgcagactatgctgtgaaagtacctgaaaaattagatccagcagcagcg
tcttctattacatgcgcaggtgtgacaacttataaagctgtaaaagtaagtaatgtaaaa
cctggacaatggttaggtgtttttggtataggtggtttaggtaacctagctttacaatat
gctaaaaacgttatgggggctaaaattgttgccttcgacatcaatgatgataaattagca
ttcgcgaaagaattaggtgctgatgctattattaattctaaagatgttgatccagttgca
gaagttatgaaattaactgataacaaaggattagatgcaacagtggtaacttcagttgct
aagacgccatttaaccaagcggttgatgttgtaaaagctggtgcaagagttgttgccgtt
ggtttacctgttgataaaatgaacttagatatcccaagattagtgcttgatggtattgaa
gtagtaggttcacttgttggtacaagacaagacttacgtgaagcgtttgaatttgctgct
gaaaataaagtaacacctaaagttcaattaagaaaattagaagaaatcaatgatattttt
gaagaaatggaaaatggtactataactggtagaatggttattaaattttaa

DBGET integrated database retrieval system