KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00734Help
Entry
SAT0131_00734     CDS       T01888                                 

Definition
(GenBank) Phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Brite
KEGG Orthology (KO) [BR:sut00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SAT0131_00734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEB87799
Position
731858..732865
Genome map
AA seq 335 aa AA seqDB search
MSYIIIVTIAVVIFSLIFDFINGFHDTANAVATAVSTRALTPKTAILMAAVMNFIGALTF
TGVAGTITKDIVDPFKLENGLVVVLAAILAAIIWNLATWFYGIPSSSSHALIGSIAGAAI
ASEGSFGVLHYQGFTKIIIVLIVSPIIAFCVGFLMYSIFKVIFKNANLTRANRNFRFFQI
FTAALQSFSHGTNDAQKSMGIITLALIVANVQNDGSVEPQLWVKFACATAMGLGTAIGGW
KIIKTVGGNIMKIRPANGAAADLSSALTIFVASSLHFPLSTTHVVSSSILGVGASNRAKG
VKWSTAQRMIITWVITLPISALLAGLLFYILNLFF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatataatcatcgtcactatagctgtagttattttctcgctgatatttgacttt
atcaatggattccatgatacagccaatgcagtagctactgctgtatctactagagcgtta
acgcctaaaacggcaattttaatggcagcagtgatgaactttataggtgctttaacattt
acgggcgttgcaggcaccattactaaagacattgtcgatccatttaaattggaaaatgga
ttagttgttgtgttagctgcaatacttgcggctattatttggaatttagctacttggttt
tacggaattccaagttcgtcttcacatgcacttataggttcaattgcgggtgcagcaatc
gcatctgaaggctcatttggagtgttacattaccaaggtttcacaaaaattattattgta
ttaatcgtttcaccgattatcgcattttgtgttggtttcttgatgtattcaatttttaaa
gttatctttaaaaatgcaaatttaacaagagcgaatcgtaactttagatttttccaaatt
ttcacagcagcgttacaatcattctctcacggtacgaatgatgcgcaaaaatcaatgggt
attattacgttggcattgattgtcgctaatgtacagaatgatggcagtgttgaaccacag
ttatgggtaaaatttgcctgtgcgacagcaatggggcttggtactgcaattggtggctgg
aaaattatcaaaactgtaggtggtaatattatgaaaatacgtccagcaaatggtgctgcg
gccgatttatcatctgcattaacaatttttgttgcatcatcgctacatttcccattatca
acaactcacgttgtgtcatcatcaatcttaggtgttggtgcttctaaccgagctaaaggt
gtaaaatggagcactgcgcaacgaatgatcattacatgggtgattacattacctatttca
gcattgttagcaggtttactattctatatacttaacttatttttctaa

DBGET integrated database retrieval system