KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_01641Help
Entry
SAT0131_01641     CDS       T01888                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
sut00010  Glycolysis / Gluconeogenesis
sut00052  Galactose metabolism
sut00500  Starch and sucrose metabolism
sut00520  Amino sugar and nucleotide sugar metabolism
sut00521  Streptomycin biosynthesis
sut01100  Metabolic pathways
sut01110  Biosynthesis of secondary metabolites
sut01120  Microbial metabolism in diverse environments
sut01130  Biosynthesis of antibiotics
sut01200  Carbon metabolism
Module
sut_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sut_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAT0131_01641
   00052 Galactose metabolism
    SAT0131_01641
   00500 Starch and sucrose metabolism
    SAT0131_01641
   00520 Amino sugar and nucleotide sugar metabolism
    SAT0131_01641
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAT0131_01641
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SAT0131_01641
Enzymes [BR:sut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAT0131_01641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEB88637
Position
complement(1630387..1631373)
Genome map
AA seq 328 aa AA seqDB search
MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTSDSTGYTLLKGIYDSFVEKVNENN
YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
GRSGCIETVASATGVVNLVNFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFAPAQFETEIV
QAKLGNDAGITGAAGLIKTYVLDEEGVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattattttagcagctgatgtaggcgggacgacttgtaaattaggtattttc
acacctgaattagaacaattacataaatggtctattcacactgatacatctgatagtaca
ggatatacacttttgaaaggaatttatgattcgtttgttgaaaaagtaaatgaaaataat
tataatttttcaaatgtacttggcgtaggtattggtgtaccaggtcctgttgactttgaa
aaaggtacagtaaatggagcagtaaacttatattggccagaaaaagttaatgtacgtgag
atttttgaacaattcgttgattgtccagtgtatgtagataatgatgctaacatagctgct
ttaggggagaaacacaaaggtgctggtgaaggtgccgatgatgttgttgccatcacactt
ggtacaggtctaggtggaggaattatttcaaatggtgaaatcgtacatggtcataatggc
tctggcgcagaaataggtcattttagagcagacttcgatcaacgatttaaatgtaattgt
ggtcgctctggatgtattgaaacagttgcttcagcgacaggcgttgttaacttagttaac
ttctactatccgaagttgacgtttagatcttctatattagaattgattaaagaaaataag
gttacagcaaaagctgtttttgatgcggcaaaagctggtgaccaattctgtattttcatt
actgaaaaggttgcaaactatattggatatttatgtagtattattagtgttacaagtaat
ccgaaatatatcgttctaggtggaggaatgtctactgcaggacctattttaattgaaaat
attaaaacagaatatcataatttaacatttgcacctgctcaatttgaaactgaaattgta
caagcgaaattaggtaatgatgcaggtattacaggagcagcaggattaatcaagacctat
gtattagatgaagagggggtaaaataa

DBGET integrated database retrieval system