KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_01796Help
Entry
SAT0131_01796     CDS       T01888                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
sut00020  Citrate cycle (TCA cycle)
sut00480  Glutathione metabolism
sut01100  Metabolic pathways
sut01110  Biosynthesis of secondary metabolites
sut01120  Microbial metabolism in diverse environments
sut01130  Biosynthesis of antibiotics
sut01200  Carbon metabolism
sut01210  2-Oxocarboxylic acid metabolism
sut01230  Biosynthesis of amino acids
Module
sut_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sut_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAT0131_01796
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SAT0131_01796
Enzymes [BR:sut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SAT0131_01796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEB88779
Position
complement(1777277..1778545)
Genome map
AA seq 422 aa AA seqDB search
MTAEKITQGTEGLNVPNEPIIPFIIGDGIGPDIWKAASRVIDAAVEKAYNGEKRIEWKEV
LAGQKAFDTTGEWLPQETLDTIKEYLIAVKGPLTTPIGGGIRSLNVALRQELDLFTCLRP
VRWFKGVPSPVKRPQDVDMVIFRENTEDIYAGIEFKEGTTEVKKVIDFLQNEMGATNIRF
PETSGIGIKPVSKEGTERLVRAAIQYAIDNNRKSVTLVHKGNIMKFTEGSFKQWGYDLAL
SEFGDQVFTWQQYDEIVENEGRDAANAAQEKAEKEGKIIIKDSIADIFLQQILTRPAEHD
VVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLNKVNPSS
VILSSVLMLEHLGWQEAADKITDSIEDTIASKVVTYDFARLMDGAEEVSTSAFADELIKN
LK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagaaaaaattactcaaggaactgaaggattaaacgtacctaatgaaccaatt
atcccatttattatcggtgatggaattggaccggatatttggaaggcagcaagccgagtt
atagatgctgctgttgagaaagcctataatggcgaaaaacgcattgaatggaaagaagtg
ctagctggccaaaaagcatttgatacaactggtgaatggttacctcaagaaacacttgat
acaattaaagaatatttaattgctgttaaaggacctttaacaacaccaattggtggtggt
attagatcattaaatgtggctttacgccaagaattagatttatttacttgcttaagaccg
gtacgttggtttaaaggagtaccatcacctgttaaacgtccacaagatgttgatatggtt
attttccgtgaaaatactgaagacatttatgctggtattgaatttaaagaaggtacaaca
gaagttaaaaaggtaattgacttcttacaaaacgaaatgggtgcgacaaacattcgattc
ccagaaacttcaggtattggtattaaaccagtttctaaagaaggaactgagcgattagtt
agagcagctatacaatatgctatcgataataaccgtaaatcagttactttagttcataaa
ggtaatattatgaaatttacagaaggctcatttaagcagtggggttacgatttagcatta
tctgaatttggtgatcaagtattcacttggcaacaatatgacgaaattgttgaaaatgaa
ggcagagatgctgctaatgctgctcaagaaaaagctgaaaaagaaggcaagattatcatt
aaagattctattgctgacattttcttacaacaaattttaactcgtccagctgagcatgat
gttgtagcaactatgaacttgaatggtgactatatttcagatgctttagctgcacaagtt
ggtggtattggtattgcgccaggtgcaaacattaattatgaaacaggtcatgctattttt
gaagcaacacatggtacagctccaaaatatgcaggtttaaataaagtgaatccatcttca
gtaattttaagttctgtattaatgttagaacatttaggatggcaagaagcggcagataag
attacagattcaattgaagatacaattgcttcaaaagttgttacttatgactttgcccgt
ttaatggatggtgctgaagaagtttctacatcagcatttgcagatgaattgattaaaaat
ttaaaataa

DBGET integrated database retrieval system